Epitope Mapping Kits

Immunogen Recombinant protein corresponding to nucleolar and spindle associated protein 1 Sequence THKLKTITGNSAAVITPFKLTTEATQTPVSNKKPVFDLKASLSRPLNYEPHKGKLKPWGQSKENNYLNQHVNRINFYKKTYKQPHLQ Application All Prestige Antibodies Powered by Atlas

Immunogen NACHT and WD repeat domain containing 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen NACHT and WD repeat domain containing 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Neurexophilin 1 (NXPH1) is a 29kDa secreted protein which is part of the neurexophilin family. It possesses a conserved N -glycosylated central domain, a cysteine-rich carboxyl-terminal domain and an amino-terminal domain.

OAS1 (2&#8242-5&#8242-oligoadenylate synthetase 1, 40/46kDa) is an interferon-inducible protein beloonging to the 2&#8242-5&#8242-Oligoadenylate synthetase family. It plays an essential role in host defense system against viral infection.

Occludin (OCLN) is an important membrane protein that is localized in the tight junction (TJ). This protein is made up of four transmembrane proteins, a short N-terminal cytoplasmic domain, two extracellular loops, one intracellular turn, and a

2-oxoglutarate dehydrogenase E1 component (OGDH) is a unique subunit of &#945-ketoglutarate dehydrogenase complex (KGDHC) which is localized to the mitochondria. The gene encoding OGDH is located on human chromosome 7 and has 22 exons.

The OGFR (Opioid growth factor receptor) gene is located on human chromosome 20q13.3.

Immunogen Obg-like ATPase 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The gene OLFML2A (olfactomedin-like protein 2A) is mapped to human chromosome 9q33.3.

The gene OLFML2A (olfactomedin-like protein 2A) is mapped to human chromosome 9q33.3.

Immunogen Oligophrenin 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the