-
Add to Cart The item has been addedHPA047295-100ULANTI-OR7C2 ANTIBODY PRODUCED IN RABBIT
Price: $1,013.20List Price: $1,125.78Immunogen olfactory receptor, family 7, subfamily C, member 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and -
Add to Cart The item has been addedHPA020514-100ULANTI-OSTF1 ANTIBODY PRODUCED IN RABBIT
Price: $959.88List Price: $1,066.53Osteoclast stimulating factor 1 (OSTF1) is a 28kDa intracellular peptide which is highly expressed in the osteoclasts. It possesses a SH3 (src homology 3) domain, a proline-rich region and ankyrin repeats. -
Add to Cart The item has been addedHPA021293-100ULANTI-OXSM (C005B-205573)
Price: $959.88List Price: $1,066.53OXSM (β-ketoacyl-ACP synthase) localizes in the mitochondria. OXSM transcripts are strongly expressed in the heart and skeletal muscle, liver and kidney. -
Add to Cart The item has been addedHPA021300-100ULANTI-OXSM (C005B-205576)
Price: $959.88List Price: $1,066.53OXSM (β-ketoacyl-ACP synthase) localizes in the mitochondria. OXSM transcripts are strongly expressed in the heart and skeletal muscle, liver and kidney. -
Add to Cart The item has been addedHPA021337-100ULANTI-OXSM (C005B-205593)
Price: $959.88List Price: $1,066.53OXSM (β-ketoacyl-ACP synthase) localizes in the mitochondria. OXSM transcripts are strongly expressed in the heart and skeletal muscle, liver and kidney. -
Add to Cart The item has been addedHPA043695-100ULANTI-P3H3
Price: $1,013.20List Price: $1,125.78Immunogen Recombinant protein corresponding to prolyl 3-hydroxylase 3 Sequence PMHLQMREDMAKYRRMSGVRPQSFRDLETPPHWAAYDTGLELLGRQEAGLALPRLEEALQGSLAQMESCRADCEGPEEQQGAEEEEDGAASQGGLYEAIAGH Application All Prestige Antibodies Powered by Atlas Antibodies -
Add to Cart The item has been addedHPA045423-100ULANTI-PABPC1 ANTIBODY PRODUCED IN RABBIT (C005B-213933)
Price: $1,013.20List Price: $1,125.78Immunogen poly(A) binding protein, cytoplasmic 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA066650-100ULANTI-PABPC1L (C005B-220365)
Price: $1,013.20List Price: $1,125.78Immunogen poly(A) binding protein, cytoplasmic 1-like Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA030810-100ULANTI-PADI4 ANTIBODY PRODUCED IN RABBIT (C005B-208477)
Price: $959.88List Price: $1,066.53Immunogen Protein-arginine deiminase type-6 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA073653-100ULANTI-PAIP1 (C005B-221635)
Price: $1,013.20List Price: $1,125.78Immunogen Recombinant protein corresponding to poly(A) binding protein interacting protein 1 Sequence GTNGQVTRADILQVGLRELLNALFSNPMDDNLICAVKLLKLTGSVLEDAWKEKGKMDMEEIIQRIENVVLDANCSRDVKQMLLK Application All Prestige Antibodies Powered by Atlas -
Add to Cart The item has been addedHPA046936-100ULANTI-PAQR7 ANTIBODY PRODUCED IN RABBIT
Price: $1,013.20List Price: $1,125.78Immunogen progestin and adipoQ receptor family member VII recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as -
Add to Cart The item has been addedHPA012010-100ULANTI-PARN (C005B-203576)
Price: $959.88List Price: $1,066.53Immunogen Poly(A)-specific ribonuclease PARN recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are
