Epitope Mapping Kits

Immunogen parvin beta Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen PAS domain-containing serine/threonine-protein kinase recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project

The gene PASK (PAS domain-containing serine/threonine-protein kinase) is mapped to human chromosome 2q37. The protein is present in the cytoplasm as well as nucleus.

Immunogen pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1) 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed

Immunogen Recombinant protein corresponding to protocadherin 20 Sequence GAEWNPPLSFSLASRGLSGQYVTLDNRSGELHTSAQEIDREALCVEGGGGTAWSGSVSISSSPSDSCLLLLDVLVLPQEYFRFV Application All Prestige Antibodies Powered by Atlas Antibodies are developed and

PCDH8 (protocadherin 8) belongs to the protocadherin subfamily of cadherin superfamily. All protocadherins share six ertracellular cadherin domains and a transmembrane domain, with different cytoplasmic domains.

Immunogen protocadherin alpha 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by

Immunogen Protocadherin beta-10 precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

PCDHB14 (protocadherin &#94614) belongs to protocadherin family. It is mostly expressed in the nervous system.

Immunogen Protocadherin &#946 15 precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen Protocadherin beta-5 precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

The gene PCM1 (pericentriolar material 1) is mapped to human chromosome 8p22. The encoded protein localizes to cytoplasmic granules known as ‘centriolar satellites′, which are present around the centrosome.