-
Add to Cart The item has been addedHPA036587-100ULANTI-PIWIL4 (C005B-209997)
Price: $1,013.20List Price: $1,125.78Immunogen Recombinant protein corresponding to piwi like RNA-mediated gene silencing 4 Sequence GRARVKARGIARSPSATEVGRIQASPLPRSVDLSNNEASSSNGFLGTSRISTNDKYGISSGDAGSTFMERGVKNKQDFMDLSICTREKLAHVRNCKTGS Application All Prestige Antibodies Powered by Atlas -
Add to Cart The item has been addedHPA030156-100ULANTI-PKIB (C005B-208199)
Price: $959.88List Price: $1,066.53Immunogen protein kinase (cAMP-dependent, catalytic) inhibitor beta recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) -
Add to Cart The item has been addedHPA042703-100ULANTI-PKIG (C005B-212793)
Price: $1,013.20List Price: $1,125.78Immunogen protein kinase (cAMP-dependent, catalytic) inhibitor gamma recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) -
Add to Cart The item has been addedHPA070796-100ULANTI-PLAU ANTIBODY PRODUCED IN RABBIT (C005B-221137)
Price: $1,066.53List Price: $1,185.03Immunogen plasminogen activator, urokinase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
Add to Cart The item has been addedHPA017163-100ULANTI-PLBD2 ANTIBODY PRODUCED IN RABBIT
Price: $959.88List Price: $1,066.53PLBD2 (phospholipase B domain containing 2) is a ~76kDa lysosomal localized protein. It consists of six N -glycosylation sites. -
Add to Cart The item has been addedHPA072705-100ULANTI-PLCH2
Price: $1,013.20List Price: $1,125.78Immunogen Recombinant protein corresponding to phospholipase C eta 2 Sequence AEEDVESGEDAGASRRNGRLVVGSFSRRKKKGSKLKKAASVEEGDEGQDSPGGQSRGATRQKKTMKLSR Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the -
Add to Cart The item has been addedHPA057341-100ULANTI-PLEK (C005B-217937)
Price: $1,013.20List Price: $1,125.78Immunogen Recombinant protein corresponding to pleckstrin Sequence AFLEERDAWVRDINKAIKCIEGGQKFARKSTRRSIRLPETIDLGALYLSMKDTEKGIKELNLEKDKKIFNHCFTGNC Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the -
Add to Cart The item has been addedHPA028157-100ULANTI-PLEKHA6 ANTIBODY PRODUCED IN RABBIT (C005B-207396)
Price: $1,066.53List Price: $1,185.03Immunogen pleckstrin homology domain containing A6 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA048054-100ULANTI-PLEKHG2 ANTIBODY PRODUCED IN RABBIT (C005B-214817)
Price: $1,013.20List Price: $1,125.78Immunogen pleckstrin homology domain containing, family G (with RhoGef domain) member 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human -
Add to Cart The item has been addedHPA062856-100ULANTI-PLEKHG7 ANTIBODY PRODUCED IN RABBIT (C005B-219474)
Price: $1,066.53List Price: $1,185.03Immunogen chromosome 12 open reading frame 74 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
Add to Cart The item has been addedHPA051638-100ULANTI-PLK1 ANTIBODY PRODUCED IN RABBIT
Price: $1,013.20List Price: $1,125.78Immunogen polo-like kinase 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
Add to Cart The item has been addedHPA035026-100ULANTI-PLK4 (C005B-209242)
Price: $1,013.20List Price: $1,125.78Immunogen polo-like kinase 4 (Drosophila) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are
