-
Add to Cart The item has been addedHPA077485-100ULANTI-BSPRY ANTIBODY PRODUCED IN RABBIT (C005B-222248)
Price: $1,066.53List Price: $1,185.03Immunogen B-box and SPRY domain containing Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
Add to Cart The item has been addedHPA070682-100ULANTI-BTAF1
Price: $1,013.20List Price: $1,125.78Immunogen BTAF1 RNA polymerase II, B-TFIID transcription factor-associated, 170kDa Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
Add to Cart The item has been addedHPA003601-100ULANTI-BUB3 (C005B-202041)
Price: $959.88List Price: $1,066.53Mitotic checkpoint protein BUB3 is a protein encoded by the BUB3 gene in humans. In humans, this gene has seven exons and six introns and spans a genomic region of over 16kb. -
Add to Cart The item has been addedHPA007968-100ULANTI-C10ORF54 (C005B-202936)
Price: $959.88List Price: $1,066.53Immunogen V-set immunoregulatory receptor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA012748-100ULANTI-C11ORF24 (C005B-203707)
Price: $959.88List Price: $1,066.53Protein DM4E3 (C11orf24) is a 449-amino acid protein which has a signal peptide at the N-terminal end and a transmembrane domain in the C-terminal region. It is localized to the Golgi apparatus and the trans-Golgi network. -
Add to Cart The item has been addedHPA077658-100ULANTI-C11ORF63
Price: $1,013.20List Price: $1,125.78Immunogen Recombinant protein corresponding to chromosome 11 open reading frame 63 Sequence YAKQVKEYNMKTLSILSKPQTEKTQKKSAIPRQKALEYAKTIPKPKPSNLTHQASKEQKNPTYAGKEESLPEISLLEI Application All Prestige Antibodies Powered by Atlas Antibodies are developed -
Add to Cart The item has been addedHPA077748-100ULANTI-C11ORF63 (C005B-222289)
Price: $1,013.20List Price: $1,125.78Immunogen Recombinant protein corresponding to chromosome 11 open reading frame 63 Sequence ELSDSDLEEKSSSLSPYVKSSSSHNEVFLPGSRGPRRRKSKQHFVEKNKLTLGLPTPKTDSYLQLHNKKRGESHPEQ Application All Prestige Antibodies Powered by Atlas Antibodies are developed -
Add to Cart The item has been addedHPA055389-100ULANTI-C16ORF59 (C005B-217324)
Price: $1,013.20List Price: $1,125.78Immunogen Recombinant protein corresponding to chromosome 16 open reading frame 59 Sequence EKAVRVRRGITKAGERDKAPSLKSRSIVTSSGTTASAPPHSPGQAGGHASDTRPTKGLRQTTVPAKGHPERRLLSVGDGTRVGM Application All Prestige Antibodies Powered by Atlas Antibodies are -
Add to Cart The item has been addedHPA004061-100ULANTI-C17ORF75 (C005B-202150)
Price: $959.88List Price: $1,066.53Chromosome 17 open reading frame 75 (C17orf75) is known as NJMU-R1. Immunogen Protein Njmu-R1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human -
Add to Cart The item has been addedHPA011888-100ULANTI-C1ORF116 (C005B-203535)
Price: $959.88List Price: $1,066.53Immunogen Specifically androgen-regulated gene protein recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
Add to Cart The item has been addedHPA011889-100ULANTI-C1ORF116 (C005B-203536)
Price: $959.88List Price: $1,066.53Immunogen Specifically androgen-regulated gene protein recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
Add to Cart The item has been addedHPA010019-100ULANTI-C1ORF159 (C005B-203247)
Price: $959.88List Price: $1,066.53C1orf159 gene is localized to human chromosome 1p36.33-36.
