Epitope Mapping Kits

C1orf43 (chromosome 1 open reading frame 43) belongs to epidermal differentiation complex (EDC) family of genes. It is mapped to human chromosome 1q21, and has three cDNA variants owing to alternative splicing.

Immunogen Complement C1q subcomponent subunit C precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as

Immunogen complement component 1, r subcomponent recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

In Chlamydomonas reinhardtii C21orf59 is localized exclusively to the flagellar matrix. It is cytoplasmic in rat trachea ciliated epithelial cells and colocalizes with spindle assembly abnormal protein-6 (SAS6), suggesting a centrosomal

Specificity Note: The Ensemble Gene ID has changed from ENSG00000185838 in the 46:36 release of the database to ENSG00000215012 in the 48:36 release of the database. Immunogen Uncharacterized protein C22orf29 recombinant protein epitope signature

C2CD2L (C2 domain containing protein 2 like) is a type I transmembrane protein, which has its C-terminal facing the cytosol and the N-terminal projecting into the lumen. This gene maps to human chromosome 11q23.

The gene C8orf48 (chromosome 8 open reading frame 48) is mapped to human chromosome 8p and is not well-characterized. It is one of the genes which is differentially regulated in senescent hMSCs (human mesenchymal stem cells).

The gene C8orf58 (chromosome 8 open reading frame 58) is mapped to human chromosome 8p21.3.

The gene C8orf58 (chromosome 8 open reading frame 58) is mapped to human chromosome 8p21.3.

Immunogen Recombinant protein corresponding to Cdk5 and Abl enzyme substrate 1 Sequence SRGRLNSFTQGILPIAFSRPTSQNYCSLEQPGQGGSTSAFEQLQRSRRRLISQRSSLETLEDIEENAPLRRCRTLSGSPRPKN Application All Prestige Antibodies Powered by Atlas Antibodies are

Immunogen calcium voltage-gated channel subunit alpha1 A Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen calcium voltage-gated channel subunit alpha1 B Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive