-
Add to Cart The item has been addedHPA023343-100ULANTI-CACNB1 (C005B-206090)
Price: $959.88List Price: $1,066.53The gene CACNB1 (calcium voltage-gated channel auxiliary subunit β 1) encodes a member of the calcium channel β subunit family. The gene spanning a length of 25kb contains 13 exons and is mapped to human chromosome 17. -
Add to Cart The item has been addedHPA050611-100ULANTI-CACUL1 (C005B-215735)
Price: $1,013.20List Price: $1,125.78Immunogen Recombinant protein corresponding to CDK2-associated, cullin domain 1. Sequence ASSTININTSTSKFLMNVITIEDYKSTYWPKLDGAIDQLLTQSPGDYIPISYEQIYSCVYKCVCQQHSEQMY Application All Prestige Antibodies Powered by Atlas Antibodies are developed and -
Add to Cart The item has been addedHPA025753-100ULANTI-CACYBP (C005B-206670)
Price: $959.88List Price: $1,066.53The gene CACYBP (calcyclin binding protein) is mapped to human chromosome 1q25.1. -
Add to Cart The item has been addedHPA057038-100ULANTI-CACYBP (C005B-217842)
Price: $1,013.20List Price: $1,125.78Immunogen calcyclin binding protein Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA057266-100ULANTI-CAD (C005B-217907)
Price: $1,013.20List Price: $1,125.78Immunogen carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA069341-100ULANTI-CAD (C005B-220893)
Price: $1,013.20List Price: $1,125.78Immunogen carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA056734-100ULANTI-CALB1 ANTIBODY PRODUCED IN RABBIT (C005B-217743)
Price: $1,013.20List Price: $1,125.78Immunogen calbindin 1, 28kDa Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. -
Add to Cart The item has been addedHPA007305-100ULANTI-CALB2 (C005B-202797)
Price: $959.88List Price: $1,066.53CALB2 (calbindin 2) gene encodes a calcium-binding protein belonging to the troponin C superfamily. It is also called as calretinin. -
Add to Cart The item has been addedHPA022989-100ULANTI-CALCOCO2 (C005B-205936)
Price: $959.88List Price: $1,066.53CALCOCO2 (calcium binding and coiled-coil domain 2) is localized with P (processing)-bodies. The gene is mapped to human chromosome 17q21. -
Add to Cart The item has been addedHPA023019-100ULANTI-CALCOCO2 (C005B-205952)
Price: $959.88List Price: $1,066.53CALCOCO2 (calcium binding and coiled-coil domain 2) is localized with P (processing)-bodies. The gene is mapped to human chromosome 17q21. -
Add to Cart The item has been addedHPA023195-100ULANTI-CALCOCO2 (C005B-206022)
Price: $959.88List Price: $1,066.53CALCOCO2 (calcium binding and coiled-coil domain 2) is localized with P (processing)-bodies. The gene is mapped to human chromosome 17q21. -
Add to Cart The item has been addedHPA014706-100ULANTI-CALHM2 ANTIBODY PRODUCED IN RABBIT PRESTIGE ANTIBODY(R) POWERED BY ATLAS AFFINITY ISOLATED ANTIBODY
Price: $959.88List Price: $1,066.53CALHM2 (calcium homeostasis modulator 2) belongs to the CALHM family of proteins, and is located on human chromosome 10q24.33.
