Epitope Mapping Kits

Immunogen Cysteinyl-tRNA synthetase, cytoplasmic recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Immunogen Cysteinyl-tRNA synthetase, cytoplasmic recombinant protein epitope signature tag (PrEST) Sequence HLFEQYREKRPEAAQLLEDVQAALKPFSVKLNETTDPDKKQMLERIQHAVQLATEPLEKAVQSRLTGEEVNSCVEVLLEEAKDLLSDWLDSTLGCDVTDNSIFSKLPKFWEGDFHRDMEALNVLPPDVL

Immunogen cancer susceptibility candidate 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization

Immunogen Recombinant protein corresponding to CASK interacting protein 2 Sequence GHIHESQRGTDRIGYFPPGIVEVVSKRVGIPAARLPSAPTPLRPGFSRTPQPPAEEPPHPLTYSQLPRVGLSPDSPAGDRNSV Application All Prestige Antibodies Powered by Atlas Antibodies are developed and

Immunogen caspase 9, apoptosis-related cysteine peptidase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

The gene casitas B-lineage lymphoma proto-oncogene b (CBLB) is mapped to human chromosome 3q13.11.

CBLL1 (Cbl proto-oncogene-like 1, E3 ubiquitin protein ligase) is a cbl-like ubiquitin ligase of E-cadherin complex. It is expressed in the neurons of central nervous system.

The gene CBR3 (carbonyl reductase [NADPH] 3) is mapped to human chromosome 21q22.2.

CBS (cystathionine-&#946-synthase) contains amino-terminal heme binding, central catalytic, and carboxyl-terminal regulatory domains. Immunogen Cystathionine beta-synthase recombinant protein epitope signature tag (PrEST) Application All Prestige

Chromobox homolog 4 (CBX4) is an E3 small ubiquitin-like modifier (SUMO)-protein ligase which belongs to the polycomb group (PcG) of multiproteins. Immunogen E3 SUMO-protein ligase CBX4 recombinant protein epitope signature tag (PrEST) Application

Immunogen chibby homolog 3 (Drosophila) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

The gene CCBL1 (cysteine-S-conjugate &#946-lyase) is expressed in the brain. CCBL1 belongs to aminotransferases fold type I subfamily.