Epitope Mapping Kits

Immunogen Recombinant protein corresponding to cell division cycle 123 Sequence DSLLFTWEELISENNLNGDFSEVDAQEQDSPAFRCTNSEVTVQPSPYLSYRLPKDFVDLSTGEDAHKLIDFLKLKRNQQEDD Application All Prestige Antibodies Powered by Atlas Antibodies are developed and

Immunogen Dual specificity protein phosphatase CDC14B recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen Recombinant protein corresponding to cell division cycle 14B Sequence RCSSTSPGVKKIRSSTQQDPRRRDPQDDVYLDITDRLCFAILYSRPKSASNVHY Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein

Immunogen cell division cycle 25A Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen cell division cycle 25B Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen cell division cycle 25B Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen cell division cycle 25C Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen cell division cycle 27 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

CDC34 (cell division cycle 34), a ubiquitin carrier protein, belongs to the ubiquitin-conjugating enzyme family. Immunogen Ubiquitin-conjugating enzyme E2 R1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies

Immunogen Hsp90 co-chaperone Cdc37 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported

The gene CDC37L1 (Hsp90 co-chaperone Cdc37-like 1) is mapped to human chromosome 9p24.1.

CDC42EP4 (CDC42 effector protein 4) belongs to the BORG (binder of Rho GTPases) family of proteins. It is widely expressed and the gene is mapped to human chromosome 17q24-25.