Epitope Mapping Kits

Immunogen coiled-coil-helix-coiled-coil-helix domain containing 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project

Immunogen coiled-coil-helix-coiled-coil-helix domain containing 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Immunogen coiled-coil-helix-coiled-coil-helix domain containing 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project

Immunogen coiled-coil-helix-coiled-coil-helix domain containing 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Specificity Chondroitin sulfate proteoglycan (CSPG), protein core epitope Immunogen Epitope: Core Protein Epitope Application Immunohistochemistry: 1:2,000 on 4% paraformaldehyde fixed frozen tissue. Immunocytochemistry: 1:500 on primary

Calcineurin homologous protein 1 (CHP1) is a myristoylated EF-hand Ca(2+)-binding protein. Its expression is localized to the plasma membrane, golgi apparatus, and the nucleus.

CHRDL2 (Chordin-like 2) is a novel chordin-related gene belonging to the chordin family of proteins. It encodes a putative extracellular matrix protein consistsing of a signal peptide and three cysteine-rich (CR) domains.

Immunogen chordin like 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen Recombinant protein corresponding to cholinergic receptor nicotinic delta subunit Sequence LVRRSSSLGYISKAEEYFLLKSRSDLMFEKQSERHGLARRLTTARRPPASSEQAQQELFNELKPAVDGANFIVNHMRDQNNYNEEKDSWNRV Application All Prestige Antibodies Powered by Atlas

Carbohydrate sulfotransferase 10 (CHST10) belongs to the human natural killer-1 (HNK-1) sulfotransferase gene family. The gene encoding this protein is located on chromosome 2.

Immunogen carbohydrate (N-acetylglucosamine 6-O) sulfotransferase 7 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)

Immunogen Carbohydrate sulfotransferase 9 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are