-
HPA006871-100UL
ANTI-CMC2 (C005B-202685)
Price: $959.88List Price: $1,066.53Immunogen Uncharacterized protein C16orf61 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA054424-100UL
ANTI-CMIP (C005B-217011)
Price: $1,013.20List Price: $1,125.78Immunogen c-Maf inducing protein Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA066710-100UL
ANTI-CMIP (C005B-220376)
Price: $1,013.20List Price: $1,125.78Immunogen c-Maf inducing protein Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA013801-100UL
ANTI-CMTM1 (C005B-203865)
Price: $959.88List Price: $1,066.53Immunogen chemokine-like factor superfamily 1 isoform 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
HPA063491-100UL
ANTI-CMTM6 ANTIBODY PRODUCED IN RABBIT (C005B-219633)
Price: $1,066.53List Price: $1,185.03Immunogen CKLF like MARVEL transmembrane domain containing 6 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA063097-100UL
ANTI-CNBP (C005B-219539)
Price: $1,013.20List Price: $1,125.78Immunogen CCHC-type zinc finger, nucleic acid binding protein Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA016711-100UL
ANTI-CNNM3 (C005B-204391)
Price: $959.88List Price: $1,066.53Immunogen cyclin and CBS domain divalent metal cation transport mediator 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the -
HPA005737-100UL
ANTI-CNOT4 (C005B-202430)
Price: $959.88List Price: $1,066.53Immunogen CCR4-NOT transcription complex subunit 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
HPA014166-100UL
ANTI-CNPY4 (C005B-203920)
Price: $959.88List Price: $1,066.53Immunogen Protein canopy homolog 4 precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA007225-100UL
ANTI-CNST (C005B-202773)
Price: $959.88List Price: $1,066.53Immunogen Uncharacterized protein C1orf71 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA070467-100UL
ANTI-CNTN1 (C005B-221077)
Price: $1,013.20List Price: $1,125.78Immunogen Recombinant protein corresponding to contactin 1 Sequence TNGNLYIANVEASDKGNYSCFVSSPSITKSVFSKFIPLIPIPERTTKPYPADIVVQFKDVYALMGQ Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein -
HPA003341-100UL
ANTI-CNTN3 (C005B-201933)
Price: $959.88List Price: $1,066.53Immunogen Contactin-3 precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by