-
Add to Cart The item has been addedHPA049101-100ULANTI-DGKD ANTIBODY PRODUCED IN RABBIT (C005B-215204)
Price: $1,013.20List Price: $1,125.78Immunogen diacylglycerol kinase, delta 130kDa recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
Add to Cart The item has been addedHPA017167-100ULANTI-DGKE
Price: $959.88List Price: $1,066.53Immunogen Diacylglycerol kinase epsilon recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA051336-100ULANTI-DGKZ ANTIBODY PRODUCED IN RABBIT
Price: $1,118.92List Price: $1,243.24Immunogen diacylglycerol kinase, zeta recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA022991-100ULANTI-DHRS13 (C005B-205938)
Price: $959.88List Price: $1,066.53DHRS13 (dehydrogenase/reductase (SDR family) member 13) belongs to the SDR7C (short chain dehydrogenase/reductase family 7C) retinol dehydrogenase family of proteins. Immunogen Dehydrogenase/reductase SDR family member 13 Precursor recombinant -
Add to Cart The item has been addedHPA052516-100ULANTI-DIP2A ANTIBODY PRODUCED IN RABBIT
Price: $1,013.20List Price: $1,125.78Immunogen DIP2 disco-interacting protein 2 homolog A (Drosophila) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project -
Add to Cart The item has been addedHPA046133-100ULANTI-DIP2B ANTIBODY PRODUCED IN RABBIT (C005B-214156)
Price: $1,013.20List Price: $1,125.78Immunogen DIP2 disco-interacting protein 2 homolog B (Drosophila) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project -
Add to Cart The item has been addedHPA056045-100ULANTI-DIP2B ANTIBODY PRODUCED IN RABBIT (C005B-217542)
Price: $1,013.20List Price: $1,125.78Immunogen DIP2 disco-interacting protein 2 homolog B (Drosophila) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been addedHPA030264-100ULANTI-DIP2C (C005B-208255)
Price: $959.88List Price: $1,066.53Immunogen DIP2 disco-interacting protein 2 homolog C (Drosophila) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project -
Add to Cart The item has been addedHPA068508-100ULANTI-DIRC1 (C005B-220734)
Price: $1,013.20List Price: $1,125.78Immunogen Recombinant protein corresponding to disrupted in renal carcinoma 1 Sequence EPSIISDTCFYKPITKDQLSSRSELNTVRLKCLNSLRGWKILNQLS Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein -
Add to Cart The item has been addedHPA072579-100ULANTI-DIRC2 (C005B-221456)
Price: $1,013.20List Price: $1,125.78Immunogen disrupted in renal carcinoma 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
Add to Cart The item has been addedHPA035796-100ULANTI-DIS3L2 ANTIBODY PRODUCED IN RABBIT
Price: $1,013.20List Price: $1,125.78Immunogen DIS3 like 3′-5′ exoribonuclease 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA059903-100ULANTI-DISP2 ANTIBODY PRODUCED IN RABBIT
Price: $1,013.20List Price: $1,125.78Immunogen dispatched homolog 2 (Drosophila) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization
