-
Add to Cart The item has been addedHPA000447-100ULANTI-DKC1 (C005B-201057)
Price: $959.88List Price: $1,066.53Immunogen H/ACA ribonucleoprotein complex subunit 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
Add to Cart The item has been addedHPA052611-100ULANTI-DKK2 (C005B-216425)
Price: $1,013.20List Price: $1,125.78Immunogen Recombinant protein corresponding to dickkopf WNT signaling pathway inhibitor 2 Sequence MCCPSTRCNNGICIPVTESILTPHIPALDGTRHRDRNHGHYSNHDLGWQNLGRPHTKMSHIKGHEGDPCLRSSDCIEGFCC Application All Prestige Antibodies Powered by Atlas Antibodies are -
Add to Cart The item has been addedHPA011868-100ULANTI-DKK3 (C005B-203529)
Price: $959.88List Price: $1,066.53Immunogen Dickkopf-related protein 3 precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
Add to Cart The item has been addedHPA062262-100ULANTI-DLK1 ANTIBODY PRODUCED IN RABBIT
Price: $1,013.20List Price: $1,125.78Immunogen delta-like 1 homolog (Drosophila) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
Add to Cart The item has been addedHPA061223-100ULANTI-DLK2 ANTIBODY PRODUCED IN RABBIT (C005B-218997)
Price: $1,013.20List Price: $1,125.78Immunogen delta-like 2 homolog (Drosophila) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
Add to Cart The item has been addedHPA068672-100ULANTI-DLK2 (C005B-220761)
Price: $1,013.20List Price: $1,125.78Immunogen delta-like 2 homolog (Drosophila) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
Add to Cart The item has been addedHPA058553-100ULANTI-DMRTB1 ANTIBODY PRODUCED IN RABBIT (C005B-218280)
Price: $1,013.20List Price: $1,125.78Immunogen DMRT-like family B with proline-rich C-terminal, 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA024290-100ULANTI-DMTN (C005B-206416)
Price: $959.88List Price: $1,066.53Immunogen Dematin recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been addedHPA074239-100ULANTI-DNAAF1
Price: $1,013.20List Price: $1,125.78Immunogen Recombinant protein corresponding to dynein axonemal assembly factor 1 Sequence SLEDQNMCFPKIEVISSLSDDSDPELDYTSLPVLENLPTDTLSNIFAVSKDTSKAARVPFTDIFK Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated -
Add to Cart The item has been addedHPA002894-100ULANTI-DNAAF2 (C005B-201741)
Price: $959.88List Price: $1,066.53Immunogen Protein kintoun recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the -
Add to Cart The item has been addedHPA056220-100ULANTI-DNAAF3 (C005B-217594)
Price: $1,013.20List Price: $1,125.78Immunogen dynein, axonemal, assembly factor 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
Add to Cart The item has been addedHPA020243-100ULANTI-DNAAF5 (C005B-205314)
Price: $959.88List Price: $1,066.53HEAT repeat-containing protein 2 (HEATR2) is localized to the cytoplasm and the gene encoding it is present on human chromosome 7. Immunogen dynein, axonemal, assembly factor 5 Application All Prestige Antibodies Powered by Atlas Antibodies are
