-
Add to Cart The item has been addedHPA044087-100ULANTI-ALKBH1 ANTIBODY PRODUCED IN RABBIT (C005B-213456)
Price: $1,013.20List Price: $1,125.78Immunogen alkB, alkylation repair homolog 1 (E. coli) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
Add to Cart The item has been addedHPA039571-100ULANTI-ALKBH7 ANTIBODY PRODUCED IN RABBIT (C005B-211304)
Price: $1,013.20List Price: $1,125.78Immunogen alkB, alkylation repair homolog 7 (E. coli) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA038724-100ULANTI-ALKBH8 ANTIBODY PRODUCED IN RABBIT (C005B-210931)
Price: $1,013.20List Price: $1,125.78Immunogen alkB, alkylation repair homolog 8 (E. coli) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA061514-100ULANTI-ALKBH8 ANTIBODY PRODUCED IN RABBIT (C005B-219101)
Price: $1,013.20List Price: $1,125.78Immunogen alkB, alkylation repair homolog 8 (E. coli) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA078597-100ULANTI-ALOXE3 (C005B-222381)
Price: $1,013.20List Price: $1,125.78Immunogen Recombinant protein corresponding to arachidonate lipoxygenase 3 Sequence YQWIEGYCTVELRPGTARTICQDSLPLLLDHRTRELRARQECYRWKIYAPGFPCMVDVNSFQEMESDKKFALTKTTTCVDQGDSS Application All Prestige Antibodies Powered by Atlas Antibodies are developed -
Add to Cart The item has been addedHPA020912-100ULANTI-AMACR (C005B-205453)
Price: $959.88List Price: $1,066.53The gene AMACR (α-methylacyl-CoA racemase) is mapped to human chromosome 5p13.3. -
Add to Cart The item has been addedHPA066973-100ULANTI-AMH
Price: $1,013.20List Price: $1,125.78Immunogen Recombinant protein corresponding to anti-Mullerian hormone Sequence GEDSRLSTARLQALLFGDDHRCFTRMTPALLLLPRSEPAPLPAHGQLDTVPFPPPRPSAELEESPPSADPFLETLT Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated -
Add to Cart The item has been addedHPA030795-100ULANTI-ANGEL2 ANTIBODY PRODUCED IN RABBIT (C005B-208471)
Price: $1,066.53List Price: $1,185.03Immunogen angel homolog 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. -
Add to Cart The item has been addedHPA019358-100ULANTI-ANKIB1 (C005B-205066)
Price: $959.88List Price: $1,066.53The gene ANKIB1 (ankyrin repeat and IBR domain-containing protein 1) is mapped to human chromosome 7q21.2. -
Add to Cart The item has been addedHPA021759-100ULANTI-ANKRD40 (C005B-205726)
Price: $959.88List Price: $1,066.53The gene ANKRD40 (ankyrin repeat domain-containing protein 40) is mapped to human chromosome 17q21.33. -
Add to Cart The item has been addedHPA018535-100ULANTI-ANXA13 (C005B-204849)
Price: $959.88List Price: $1,066.53The gene annexin A13 (ANXA13) is mapped to human chromosome 8q24.12. -
Add to Cart The item has been addedHPA013349-100ULANTI-APC (C005B-203803)
Price: $959.88List Price: $1,066.53Adenomatous polyposis coli protein (APC) is encoded by the gene mapped to human chromosome 5q. The encoded protein is composed of 2843 amino acids.
