-
Add to Cart The item has been addedHPA071325-100ULANTI-E4F1 (C005B-221251)
Price: $1,013.20List Price: $1,125.78Immunogen E4F transcription factor 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA069007-100ULANTI-E4F1 ANTIBODY PRODUCED IN RABBIT (C005B-220820)
Price: $1,066.53List Price: $1,185.03Immunogen E4F transcription factor 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA072309-100ULANTI-E4F1 ANTIBODY PRODUCED IN RABBIT (C005B-221420)
Price: $1,066.53List Price: $1,185.03Immunogen E4F transcription factor 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA006465-100ULANTI-ECD ANTIBODY PRODUCED IN RABBIT
Price: $959.88List Price: $1,066.53Immunogen ecdysoneless homolog (Drosophila) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
Add to Cart The item has been addedHPA035446-100ULANTI-ECHDC1 (C005B-209444)
Price: $1,013.20List Price: $1,125.78Immunogen Recombinant protein corresponding to ethylmalonyl-CoA decarboxylase 1 Sequence SGVMMLQLLEKVIELENWTEGKGLIVRGAKNTFSSGSDLNAVKSLGTPEDGMAVCMFMQNTLTRFMRLPLI Application All Prestige Antibodies Powered by Atlas Antibodies are developed and -
Add to Cart The item has been addedHPA063337-100ULANTI-ECSCR (C005B-219596)
Price: $1,013.20List Price: $1,125.78Immunogen Recombinant protein corresponding to endothelial cell surface expressed chemotaxis and apoptosis regulator Sequence SQPTMTQTSSSQGGLGGLSLTTEPVSSNPGYIPSSEANRPSHLSSTGT Application All Prestige Antibodies Powered by Atlas Antibodies are -
Add to Cart The item has been addedHPA036363-100ULANTI-ECT2 (C005B-209881)
Price: $1,013.20List Price: $1,125.78Immunogen Recombinant protein corresponding to epithelial cell transforming 2 Sequence SLKEVMTHINEDKRKTEAQKQIFDVVYEVDGCPANLLSSHRSLVQRVETISLGEHPCDRGEQVTLFLFNDCLEIARKRHKVIGTFRSPH Application All Prestige Antibodies Powered by Atlas Antibodies are -
Add to Cart The item has been addedHPA066137-100ULANTI-EDC3 (C005B-220279)
Price: $1,013.20List Price: $1,125.78Immunogen enhancer of mRNA decapping 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA053862-100ULANTI-EEF1A2 ANTIBODY PRODUCED IN RABBIT
Price: $1,013.20List Price: $1,125.78Immunogen eukaryotic translation elongation factor 1 alpha 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA035029-100ULANTI-EEF1B2 ANTIBODY PRODUCED IN RABBIT
Price: $1,013.20List Price: $1,125.78Immunogen eukaryotic translation elongation factor 1 beta 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA057866-100ULANTI-EEF1E1 (C005B-218075)
Price: $1,013.20List Price: $1,125.78Immunogen eukaryotic translation elongation factor 1 epsilon 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA023249-100ULANTI-EFCAB13 (C005B-206040)
Price: $959.88List Price: $1,066.53The gene EFCAB13 (EF-hand calcium binding domain 13) is mapped to human chromosome 17q21. The protein has a helix-loop-helix domain.
