-
Add to Cart The item has been addedHPA019369-100ULANTI-GCC1 (C005B-205074)
Price: $959.88List Price: $1,066.53The gene GCC1 (GRIP and coiled-coil domain-containing protein 1) is mapped to human chromosome 7q32.1. -
Add to Cart The item has been addedHPA021323-100ULANTI-GCC1 (C005B-205587)
Price: $959.88List Price: $1,066.53The gene GCC1 (GRIP and coiled-coil domain-containing protein 1) is mapped to human chromosome 7q32.1. -
Add to Cart The item has been addedHPA007034-100ULANTI-GCK (C005B-202726)
Price: $959.88List Price: $1,066.53Immunogen Glucokinase recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been addedHPA002473-100ULANTI-GCSAM
Price: $959.88List Price: $1,066.53Immunogen Germinal center B-cell-expressed transcript 2 protein recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project -
Add to Cart The item has been addedHPA027510-100ULANTI-GCSAML (C005B-207205)
Price: $959.88List Price: $1,066.53Immunogen germinal center-associated, signaling and motility-like Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been addedHPA020078-100ULANTI-GEN1 ANTIBODY PRODUCED IN RABBIT (C005B-205280)
Price: $959.88List Price: $1,066.53Immunogen Gen endonuclease homolog 1 (Drosophila) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
Add to Cart The item has been addedHPA021141-100ULANTI-GEN1 ANTIBODY PRODUCED IN RABBIT (C005B-205518)
Price: $959.88List Price: $1,066.53Immunogen Gen endonuclease homolog 1 (Drosophila) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
Add to Cart The item has been addedHPA020731-100ULANTI-GFRA3 (C005B-205429)
Price: $959.88List Price: $1,066.53GDNF family receptor α-3 (GFRA3) is expressed in the nervous system. It belongs to the GDNF receptor-alpha (GFR-α) family of proteins. -
Add to Cart The item has been addedHPA004186-100ULANTI-GIT1 (C005B-202191)
Price: $959.88List Price: $1,066.53GIT1 (G protein-coupled receptor kinase interactor 1) is an adaptor protein involved in the GTPase-activating protein activity for the ADP-ribosylating factor. It is also named as Cat-1, p95-APP1 and p95PKL. -
Add to Cart The item has been addedHPA047551-100ULANTI-GJA1 (C005B-214672)
Price: $1,013.20List Price: $1,125.78Immunogen Recombinant protein corresponding to gap junction protein alpha 1 Sequence GKSDPYHATSGALSPAKDCGSQKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNYNKQAS Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by -
Add to Cart The item has been addedHPA074472-100ULANTI-GJB3 (C005B-221782)
Price: $1,013.20List Price: $1,125.78Immunogen gap junction protein, beta 3, 31kDa Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
Add to Cart The item has been addedHPA055112-100ULANTI-GJB4 (C005B-217219)
Price: $1,107.73List Price: $1,230.81Immunogen gap junction protein, beta 4, 30.3kDa Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive
