-
Add to Cart The item has been addedHPA055327-100ULANTI-ATP6V0D2 ANTIBODY PRODUCED IN RABBIT
Price: $1,013.20List Price: $1,125.78Immunogen ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been addedHPA035083-100ULANTI-ATP6V1A (C005B-209275)
Price: $1,013.20List Price: $1,125.78Immunogen ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been addedHPA035084-100ULANTI-ATP6V1A (C005B-209276)
Price: $1,013.20List Price: $1,125.78Immunogen ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been addedHPA031847-100ULANTI-ATP6V1B1 ANTIBODY PRODUCED IN RABBIT
Price: $970.54List Price: $1,078.38Immunogen ATPase, H+ transporting, lysosomal 56/58kDa, V1 subunit B1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been addedHPA023943-100ULANTI-ATP6V1C1 (C005B-206287)
Price: $959.88List Price: $1,066.53ATP6V1C1 (ATPase H + transporting V1 subunit C1) is a subunit and regulator of V-ATPase (vacuolar ATPase). Immunogen V-type proton ATPase subunit C 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by -
Add to Cart The item has been addedHPA057297-100ULANTI-ATP6V1C1 (C005B-217922)
Price: $1,013.20List Price: $1,125.78Immunogen ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been addedHPA067305-100ULANTI-ATP6V1C2 (C005B-220516)
Price: $1,013.20List Price: $1,125.78Immunogen Recombinant protein corresponding to ATPase H+ transporting V1 subunit C2 Sequence YPVKQPLVSVVDTIAKQLAQIEMDLKSRTAAYNTLKTNLENLEKKSMGNLFTRTLSDIVSKED Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated -
Add to Cart The item has been addedHPA057316-100ULANTI-ATP6V1D ANTIBODY PRODUCED IN RABBIT (C005B-217930)
Price: $1,013.20List Price: $1,125.78Immunogen ATPase, H+ transporting, lysosomal 34kDa, V1 subunit D Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been addedHPA052784-100ULANTI-ATP6V1E2 ANTIBODY PRODUCED IN RABBIT (C005B-216486)
Price: $1,013.20List Price: $1,125.78Immunogen ATPase, H+ transporting, lysosomal 31kDa, V1 subunit E2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project -
Add to Cart The item has been addedHPA048700-100ULANTI-ATP6V1F ANTIBODY PRODUCED IN RABBIT (C005B-215078)
Price: $1,013.20List Price: $1,125.78Immunogen ATPase, H+ transporting, lysosomal 14kDa, V1 subunit F Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been addedHPA062011-100ULANTI-ATP6V1F ANTIBODY PRODUCED IN RABBIT (C005B-219229)
Price: $1,013.20List Price: $1,125.78Immunogen ATPase, H+ transporting, lysosomal 14kDa, V1 subunit F Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been addedHPA042898-100ULANTI-ATP6V1G1 (C005B-212886)
Price: $1,013.20List Price: $1,125.78Immunogen ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most
