-
Add to Cart The item has been addedHPA044603-100ULANTI-HPSE2 (C005B-213651)
Price: $1,013.20List Price: $1,125.78Immunogen heparanase 2 (inactive) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA075001-100ULANTI-HS2ST1 (C005B-221872)
Price: $1,013.20List Price: $1,125.78Immunogen heparan sulfate 2-O-sulfotransferase 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA002237-100ULANTI-HS3ST1 (C005B-201615)
Price: $959.88List Price: $1,066.53HSTS3T1 (heparan sulfate-glucosamine 3-sulfotransferase 1), a type II integral membrane protein, is predominantly expressed in kidney, brain and to lesser extent in heart and lung. It is composed of an amino-terminal region and a homologous -
Add to Cart The item has been addedHPA017736-100ULANTI-HS3ST2 (C005B-204600)
Price: $959.88List Price: $1,066.53Heparan sulfate glucosamine 3- O -sulfotransferase 2 (HS3ST2) is expressed in neurons. It is part of the heparan sulfate biosynthetic enzyme family and the gene encoding it is localized on chromosome 16. -
Add to Cart The item has been addedHPA071530-100ULANTI-HS3ST3A1 ANTIBODY PRODUCED IN RABBIT (C005B-221280)
Price: $1,013.20List Price: $1,125.78Immunogen heparan sulfate (glucosamine) 3-O-sulfotransferase 3A1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been addedHPA062518-100ULANTI-HS3ST3A1 (C005B-219373)
Price: $1,013.20List Price: $1,125.78Immunogen heparan sulfate (glucosamine) 3-O-sulfotransferase 3A1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been addedHPA064126-100ULANTI-HS3ST3B1 (C005B-219819)
Price: $1,013.20List Price: $1,125.78Immunogen heparan sulfate (glucosamine) 3-O-sulfotransferase 3B1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been addedHPA064677-100ULANTI-HS3ST5 (C005B-219943)
Price: $1,013.20List Price: $1,125.78Immunogen heparan sulfate (glucosamine) 3-O-sulfotransferase 5 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA034626-100ULANTI-HS6ST2
Price: $970.54List Price: $1,078.38Immunogen heparan sulfate 6-O-sulfotransferase 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA078257-100ULANTI-HS6ST3 (C005B-222352)
Price: $1,013.20List Price: $1,125.78Immunogen Recombinant protein corresponding to heparan sulfate 6-O-sulfotransferase 3 Sequence QQRYHHTKQLEHQRDRQKRREERRLQREHRDHQWPKEDGAAEGTVTEDYNSQVVRW Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by -
Add to Cart The item has been addedHPA043261-100ULANTI-HSD3B1 ANTIBODY PRODUCED IN RABBIT (C005B-213058)
Price: $1,013.20List Price: $1,125.78Immunogen hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA044028-100ULANTI-HSD3B1 ANTIBODY PRODUCED IN RABBIT (C005B-213437)
Price: $1,013.20List Price: $1,125.78Immunogen hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are
