Epitope Mapping Kits

5-hydroxytryptamine receptor 2B (HTR2B) is a 481 amino acid receptor which is expressed in the liver, kidney, lungs and heart. The gene encoding this protein in located on chromosome 2q36.

Immunogen Recombinant protein corresponding to 5-hydroxytryptamine receptor 3A Sequence LRHLVLERIAWLLCLREQSTSQRPPATSQATKTDDCSAMGNHCSHMGGPQDFEKSPRDRCSPPPPPREASLAVCGLLQELSSIRQFLEKRDEI Application All Prestige Antibodies Powered by Atlas Antibodies

Immunogen HtrA serine peptidase 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

The gene HTRA3 (high-temperature requirement factor A3) is mapped to human chromosome 4p16.1.

Immunogen HtrA serine peptidase 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

HUWE1 (HECT, UBA and WWE domain containing 1, E3 ubiquitin protein ligase) is an E3 ubiquitin ligase. It contains a region similar to the Bcl-2 homology region 3 (BH3) domain that interacts with Mcl-1 (myeloid cell leukemia 1).

Immunogen chromosome 15 open reading frame 63 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Immunogen Isoleucyl-tRNA synthetase, mitochondrial Precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and

The gene IARS2 (Isoleucyl-tRNA synthetase) is mapped to human chromosome 1q41. It is a nuclear gene coding for mitochondrial isoleucine-tRNA synthetase.

Immunogen Probable gluconokinase recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported

Immunogen idnK, gluconokinase homolog (E. coli) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

IER3IP1 (immediate early response 3 interacting protein 1) gene is localized to human chromosome 18q12, with a cDNA length of 1304bp. The encoded protein is an ER (endoplasmic reticulum)-localized protein, composed of 82 amino acids.