Epitope Mapping Kits

Immunoglobulin superfamily containing leucine rich repeat (ISLR) is a 46kDa protein with a leucine-rich repeat (LRR) having conserved flanking sequences and a C2-type immunoglobulin (Ig)-like domain. The gene encoding it is localized on human

Isochorismatase domain containing 1 (ISOC1) is expressed in peroxisomes. SOC1 contains an isochorismatase domain and two peroxisomal targeting signal (PTS).

Immunogen isoprenoid synthase domain containing recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Integrin &#945-6 (ITGA6) belongs to the integrin superfamily and is expressed in epithelial cells. The gene encoding it is present on chromosome 2q.

ITPA (Inosine triphosphatase) gene is mapped to human chromosome 20p13 encoding a protein that hydrolyses inosine triphosphate (ITP). Immunogen Inosine triphosphate pyrophosphatase recombinant protein epitope signature tag (PrEST) Application All

Immunogen Inositol 1,4,5-trisphosphate receptor type 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

PHF17 (PHD finger protein 17) is a short-lived, kidney-enriched Jade protein consisting of canonical plant homeodomain (PHD) finger and a non-canonical extended PHD with zinc-binding ability. It is localized in the nucleus and highly expressed in

Immunogen Josephin-1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Immunogen Jrk helix-turn-helix protein Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen Recombinant protein corresponding to JRK-like Sequence RFKQRHSIREINIRNERLNGDETAVEDFCNNFRDFIERENLQPE Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and

JTB (jumping translocation breakpoint) is a highly conserved transmembrane protein, and the gene to this protein is localized to human chromosome 1q21. This gene has four introns and five exons.

The gene JUNB (Jun B proto-oncogene) is mapped to human chromosome 19p13.2.