-
Add to Cart The item has been addedHPA078302-100ULANTI-KCNJ10
Price: $1,013.20List Price: $1,125.78Immunogen Recombinant protein corresponding to potassium voltage-gated channel subfamily J member 10 Sequence EFTPAISLSASGKYIADFSLFDQVVKVASPSGLRDSTVRYGDPEKLKLEESLREQAEKEGSALSVRISNV Application All Prestige Antibodies Powered by Atlas Antibodies are -
Add to Cart The item has been addedHPA048891-100ULANTI-KCNJ11 ANTIBODY PRODUCED IN RABBIT
Price: $1,013.20List Price: $1,125.78Immunogen potassium inwardly-rectifying channel, subfamily J, member 11 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been addedHPA031066-100ULANTI-KCNJ8 (C005B-208583)
Price: $1,013.20List Price: $1,125.78Immunogen potassium inwardly-rectifying channel, subfamily J, member 8 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) -
Add to Cart The item has been addedHPA019185-100ULANTI-KCNMB3 (C005B-205025)
Price: $959.88List Price: $1,066.53The gene KCNMB3 (calcium-activated potassium channel subunit β-3) is mapped to human chromosome 3q26.3-q27. -
Add to Cart The item has been addedHPA031131-100ULANTI-KCNV2 (C005B-208615)
Price: $970.54List Price: $1,078.38The KCNV2 (potassium channel, subfamily V, member 2) gene is mapped to human chromosome 9p24.2. -
Add to Cart The item has been addedHPA043524-100ULANTI-KCTD13 ANTIBODY PRODUCED IN RABBIT
Price: $1,013.20List Price: $1,125.78KCTD13 (potassium channel tetramerization domain containing 13) codes for the polymerase delta-interacting protein 1 (PDIP1). It is expressed in the developing brain. -
Add to Cart The item has been addedHPA031562-100ULANTI-KCTD8 (C005B-208782)
Price: $970.54List Price: $1,078.38KCTD8 gene is located in human chromosome 4p13. It belongs to the gene family whose members have a conserved sequence that is typical for the tetramerization domain of voltage-gated potassium channels. -
Add to Cart The item has been addedHPA039315-100ULANTI-KDELC2 ANTIBODY PRODUCED IN RABBIT (C005B-211170)
Price: $1,013.20List Price: $1,125.78Immunogen KDEL (Lys-Asp-Glu-Leu) containing 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
Add to Cart The item has been addedHPA039817-100ULANTI-KDELC2 ANTIBODY PRODUCED IN RABBIT (C005B-211415)
Price: $1,013.20List Price: $1,125.78Immunogen KDEL (Lys-Asp-Glu-Leu) containing 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
Add to Cart The item has been addedHPA066134-100ULANTI-KDELC2 (C005B-220278)
Price: $1,013.20List Price: $1,125.78Immunogen KDEL (Lys-Asp-Glu-Leu) containing 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
Add to Cart The item has been addedHPA076405-100ULANTI-KDELR3 (C005B-222082)
Price: $1,013.20List Price: $1,125.78Immunogen KDEL (Lys-Asp-Glu-Leu) endoplasmic reticulum protein retention receptor 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
Add to Cart The item has been addedHPA016610-100ULANTI-KDM3B ANTIBODY PRODUCED IN RABBIT PRESTIGE ANTIBODIES(R) POWERED BY ATLAS ANTIBODIES AFFINITY ISOLATED ANTIBODY BUFFERED AQUE (C005B-204366)
Price: $959.88List Price: $1,066.53Immunogen JmjC domain-containing histone demethylation protein 2B recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project
