Epitope Mapping Kits

The gene KIF13B (kinesin family member 13B) is mapped to human chromosome 8p12. It is strongly expressed in the brain.

Immunogen Recombinant protein corresponding to kinesin family member 13B Sequence LPSGKNDGSIGGKQYFRCNPGYGLLVRPSRVRRATGPVRRRSTGLRLGAPEARRSATLSGSATNLASLTAALAKADRSHKNPENRKSWAS Application All Prestige Antibodies Powered by Atlas Antibodies are

Kinesin family member 18A (KIF18A) is encoded by the gene mapped to human chromosome 11p14.1.

The kinesin family member 7 (KIF7) gene, with 19 exons, is mapped to human chromosome 15q26.1.

Kin17 DNA and RNA binding protein is encoded by the gene mapped to human chromosome 10p14. The encoded protein is ubiquitously expressed at low levels in human tissue, except in heart, skeletal muscle and testis.

Immunogen Recombinant protein corresponding to kin of IRRE like 2 (Drosophila) Sequence EVTLSASPHTVQEGEKVIFLCQATAQPPVTGYRWAKGGSPVLGARGPRLEVVADASFL Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the

Immunogen kin of IRRE like 3 (Drosophila) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

Immunogen KIT ligand Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen kinesin light chain 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by

Immunogen Kruppel-like factor 11 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen Kruppel-like factor 12 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen Kruppel like factor 12 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the