-
Add to Cart The item has been addedHPA076986-100ULANTI-LEMD3 (C005B-222180)
Price: $1,013.20List Price: $1,125.78Immunogen LEM domain containing 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA028064-100ULANTI-LIMK1 (C005B-207365)
Price: $959.88List Price: $1,066.53Immunogen LIM domain kinase 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
Add to Cart The item has been addedHPA028516-100ULANTI-LIMK1 (C005B-207542)
Price: $959.88List Price: $1,066.53Immunogen LIM domain kinase 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
Add to Cart The item has been addedHPA063074-100ULANTI-LIN28A ANTIBODY PRODUCED IN RABBIT (C005B-219536)
Price: $1,066.53List Price: $1,185.03Immunogen lin-28 homolog A Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. -
Add to Cart The item has been addedHPA068814-100ULANTI-LIN28A ANTIBODY PRODUCED IN RABBIT (C005B-220788)
Price: $1,066.53List Price: $1,185.03Immunogen lin-28 homolog A Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. -
Add to Cart The item has been addedHPA036630-100ULANTI-LIN28B (C005B-210013)
Price: $1,013.20List Price: $1,125.78Lin-28 homolog B (LIN28B) is expressed in embryonic stem cells. The gene encoding it is localized on human chromosome 6q21 and consists of seven exons. -
Add to Cart The item has been addedHPA043253-100ULANTI-LIN37 ANTIBODY PRODUCED IN RABBIT (C005B-213052)
Price: $1,013.20List Price: $1,125.78Immunogen lin-37 DREAM MuvB core complex component Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA047809-100ULANTI-LIN37 ANTIBODY PRODUCED IN RABBIT (C005B-214742)
Price: $1,013.20List Price: $1,125.78Immunogen lin-37 DREAM MuvB core complex component Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA056606-100ULANTI-LIN54 ANTIBODY PRODUCED IN RABBIT
Price: $1,013.20List Price: $1,125.78Immunogen lin-54 DREAM MuvB core complex component Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA071562-100ULANTI-LIN7A (C005B-221287)
Price: $1,013.20List Price: $1,125.78Immunogen Recombinant protein corresponding to lin-7 homolog A, crumbs cell polarity complex component Sequence EVPVHKLQSLKKVLQSEFCTAIREVYQYMHETITVNGCPEFRARATAKVFSCV Application All Prestige Antibodies Powered by Atlas Antibodies are developed and -
Add to Cart The item has been addedHPA051118-100ULANTI-LIN7C ANTIBODY PRODUCED IN RABBIT
Price: $1,013.20List Price: $1,125.78Immunogen lin-7 homolog C (C. elegans) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA074653-100ULANTI-LINGO1
Price: $1,013.20List Price: $1,125.78Immunogen leucine rich repeat and Ig domain containing 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive
