-
Add to Cart The item has been addedHPA038578-100ULANTI-LINS1 (C005B-210851)
Price: $1,013.20List Price: $1,125.78Immunogen lines homolog 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. -
Add to Cart The item has been addedHPA038579-100ULANTI-LINS1 (C005B-210852)
Price: $1,013.20List Price: $1,125.78Immunogen lines homolog 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. -
Add to Cart The item has been addedHPA045930-100ULANTI-LIPF ANTIBODY PRODUCED IN RABBIT
Price: $1,013.20List Price: $1,125.78Immunogen lipase, gastric recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the -
Add to Cart The item has been addedHPA016966-100ULANTI-LIPG (C005B-204456)
Price: $959.88List Price: $1,066.53LIPG (lipase, endothelial) is an important member of the triglyceride lipase gene family and lipase subfamily. It consists of N-terminal and C-terminal structural domain connected by a hinge region. -
Add to Cart The item has been addedHPA049079-100ULANTI-LIPH ANTIBODY PRODUCED IN RABBIT
Price: $1,013.20List Price: $1,125.78Immunogen lipase, member H recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the -
Add to Cart The item has been addedHPA022913-100ULANTI-LLGL2 (C005B-205906)
Price: $959.88List Price: $1,066.53Immunogen Lethal recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been addedHPA012165-100ULANTI-LMBRD2 (C005B-203617)
Price: $959.88List Price: $1,066.53Immunogen LMBR1 domain-containing protein 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA070901-100ULANTI-LMO2 ANTIBODY PRODUCED IN RABBIT (C005B-221150)
Price: $1,066.53List Price: $1,185.03Immunogen LIM domain only 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. -
Add to Cart The item has been addedHPA070910-100ULANTI-LMO2 ANTIBODY PRODUCED IN RABBIT (C005B-221151)
Price: $1,066.53List Price: $1,185.03Immunogen LIM domain only 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. -
Add to Cart The item has been addedHPA061638-100ULANTI-LMO4 ANTIBODY PRODUCED IN RABBIT (C005B-219131)
Price: $1,013.20List Price: $1,125.78Immunogen LIM domain only 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. -
Add to Cart The item has been addedHPA043642-100ULANTI-LNPEP ANTIBODY PRODUCED IN RABBIT
Price: $1,013.20List Price: $1,125.78Immunogen leucyl/cystinyl aminopeptidase recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA061162-100ULANTI-LONRF3 (C005B-218982)
Price: $1,013.20List Price: $1,125.78Immunogen Recombinant protein corresponding to LON peptidase N-terminal domain and ring finger 3 Sequence MESVRIEQMLSLPAEVSSDNLESAERGASAAQVDMGPHPKVAAEGPAPLPTREPEQEQSPGTSTPESKVLLTQ Application All Prestige Antibodies Powered by Atlas Antibodies are
