Epitope Mapping Kits

Immunogen MAP/microtubule affinity-regulating kinase 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

The gene MARK3 (microtubule affinity regulating kinase 3) is mapped to human chromosome 14q32.3.

Immunogen Recombinant protein corresponding to microtubule associated serine/threonine kinase 1 Sequence LTLREKTWRGGSPEIKRFSASEASFLEGEASPPLGARRRFSALLEPSRFSAPQEDEDE Application All Prestige Antibodies Powered by Atlas Antibodies are developed and

Immunogen mitochondrial antiviral signaling protein Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen mitochondrial antiviral signaling protein Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen Protein max recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

MBD4 (methyl-CpG binding domain 4, DNA glycosylase) is a methyl-CpG-binding endonuclease. It is a tripartite with an N-terminal 5-methylcytosine binding domain (MBD), a C-terminal catalytic domain with homology to bacterial DNA damage-specific

Immunogen membrane-bound transcription factor peptidase, site 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Immunogen multiciliate differentiation and DNA synthesis associated cell cycle protein Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen DNA replication licensing factor MCM6 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Microspherule protein 1 (MCRS1) is a nucleolar protein and also acts as an oncogene. The gene is located on human chromosome 12q13.

Immunogen MyoD family inhibitor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by