Epitope Mapping Kits

Immunogen NAD-dependent malic enzyme, mitochondrial precursor recombinant protein epitope signature tag (PrEST) Sequence

Immunogen Mediator of RNA polymerase II transcription subunit 12 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project

Mediator complex subunit 22 (MED22) which is also called Surf-5 (Surfeit 5), is expressed in the mammary glands. It is present on the human Surfeit locus.

Immunogen Recombinant protein corresponding to mediator complex subunit 26 Sequence PGAHHFMSEYLKQEESTRQGARQLHVLVPQSPPTDLPGLTREVTQDDLDRIQASQWPGVNGCQDTQGNWYDWT Application All Prestige Antibodies Powered by Atlas Antibodies are developed and

Immunogen mediator complex subunit 28 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

MEIS2 (Meis homeobox 2) gene encodes a protein belonging to the TALE (three amino acid loop extension) family of homeodomain-containing proteins. The gene is mapped to human chromosome 15q14.

Immunogen Recombinant protein corresponding to mesoderm development candidate 1 Sequence LLTQCLRDLAQHPDGGAKMSDHRERLRNSACAVSEGCTLLSQALRERSSPRTLPPVNSNSVN Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by

Immunogen mesoderm posterior bHLH transcription factor 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

The gene METTL1 (methyltransferase-like protein 1) is mapped to human chromosome 12q13. It is ubiquitously expressed.

Immunogen mex-3 RNA binding family member A Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization

Immunogen mex-3 homolog C ( C. elegans ) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen malignant fibrous histiocytoma amplified sequence 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive