Protein Assays

Anti-RGS21 regulator of G-protein signaling 21, 100ul UN 168

Anti-RGS21 regulator of G-protein signaling 21, 25ul UN 1687

Immunogen rhomboid, veinlet-like 1 (Drosophila) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen rhomboid, veinlet-like 1 (Drosophila) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen 60S ribosomal protein L30 recombinant protein epitope signature tag (PrEST) Application Anti-RPL30 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is

Immunogen Protein S100-A1 recombinant protein epitope signature tag (PrEST) Application Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below. Immunohistochemistry (1 paper)

Immunogen Recombinant protein corresponding to SCO2, cytochrome c oxidase assembly protein Sequence PTAWHRLSQLKPRVLPGTLGGQALHLRSWLLSRQGPAETGGQGQPQGPGLRTRLLITGLFGAGLGGAWLALRAEKERLQQQKRTEALRQAAVGQGDFHLLDHRG Application All Prestige Antibodies Powered

Succinate dehydrogenase complex subunit D (SDHD) gene encodes for a protein SDHD. It is a small sub unit of the cytochrome b, that is involved in the complex II of mitochondrial respiration.

SEPT7 (Septin 7) is a 418 amino acid protein and contains a guanosine triphosphate (GTP)-binding domain. The gene is mapped to human chromosome 7p14.

The gene SERAC1 (serine active site containing 1) is mapped to human chromosome 6q25.3.

Immunogen SERPINB10 (NP_005015.1, 1 a.

Anti-SERPINB13 serpin peptidase inhibitor, clade B (ovalbumi