Ribonuclease Protection Assays

General description Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit.

General description Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit.

Immunogen Synthetic peptide directed towards the C terminal region of human NOL6 Biochem/physiol Actions NOL6 is a nucleolar RNA-associated protein that is highly conserved between species. RNase treatment of permeabilized cells indicates that the

This phospho-Ribosomal Protein S6 antibody is validated for use in WB & ICC for the detection of the phospho-Ribosomal Protein S6 protein.

Immunogen Synthetic peptide directed towards the C terminal region of human POP4 Biochem/physiol Actions POP4 is a part of ribonuclease P, a protein complex that generates mature tRNA molecules by cleaving their 5&#8242-ends. It may function with

Immunogen Synthetic peptide directed towards the middle region of human RG9MTD1 Biochem/physiol Actions RG9MTD1 functions in mitochondrial tRNA maturation. Part of mitochondrial ribonuclease P, an enzyme composed of MRPP1/RG9MTD1, MRPP2/HSD17B10

Immunogen RIB43A domain with coiled-coils 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization

Immunogen RIB43A-like with coiled-coils protein 2 recombinant protein epitope signature tag (PrEST) Application Anti-RIBC2 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each

Immunogen Probable ribonuclease 11 precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen Recombinant protein corresponding to ribonuclease A family member 12 (inactive) Sequence DEAVMSTLEHLHVDYPQNDVPVPARYCNHMIIQRVIREPDHTCKKEHVFIHERPR Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated

Immunogen ribonuclease, RNase A family, 12 (non-active) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen ribonuclease, RNase A family, 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in