pI Markers

PI15 (peptidase inhibitor 15) is a trypsin-binding protein with a molecular weight of 25 kDa. It is expressed in the brain, placenta and lymphocytes, including neuroblastoma and glioblastoma cell lines.

General description This gene encodes an elastase-specific inhibitor that functions as an antimicrobial peptide against Gram-positive and Gram-negative bacteria. The protein contains a WAP-type four-disulfide core (WFDC) domain, and is thus a

Immunogen PI4KAP2 (AAH20225.1, 1 a.

Immunogen PIBF1 (NP_006337.2, 1 a.

Immunogen PIK3R3 (NP_003620.2, 1 a.

Immunogen Synthetic peptide directed towards the N terminal region of human PIM1 Sequence Synthetic peptide located within the following region: MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFG Physical form Purified antibody supplied in 1x

General description The protein encoded by this gene belongs to the Ser/Thr protein kinase family, and PIM subfamily. This gene is expressed primarily in B-lymphoid and myeloid cell lines, and is overexpressed in hematopoietic malignancies and in

General description PIKFYVE belongs to an evolutionarily ancient gene family of phosphatidylinositol 3,5-bisphosphate (PtdIns(3,5)P2)enzymes. PIKFYVE gene is located on human chromosome 2q34.

General description The protein encoded by this gene is one of at least two lipid transfer proteins found in human plasma. The encoded protein transfers phospholipids from triglyceride-rich lipoproteins to high density lipoprotein (HDL).

General description Podocalyxin (UniProt: Q52S86: also known as Gp135, Podocalyxin-like protein 1, PC, PC-like protein 1, PCLP-1, cPCLP1) is encoded by the PODXL (also known as PCLP, PCLP1) gene (Gene ID: 482252) in canine species. GP135 is an

General description Podocalyxin (UniProt: Q52S86: also known as Gp135, Podocalyxin-like protein 1, PC, PC-like protein 1, PCLP-1, cPCLP1) is encoded by the PODXL (also known as PCLP, PCLP1) gene (Gene ID: 482252) in canine species. GP135 is an

General description Tenascin-R (UniProt: Q00546: also known as TN-R, Restrictin) is encoded by the TNR gene (Gene ID: 396213) in chicken. Tenascins are a family of four large glycoproteins (Tenascin-C, R, X, and W) that share a cysteine-rich