Peptide Phage Display Libraries

Synonyms: D-ß-Phe-OH Purity Limit: &ge 99% (Assay) CAS No.: 83649-48-3 Molecular Formula: C9H11NO2 Molecular Weight: 165.

&#945-Cyano-4-hydroxycinnamic acid (&#945-CHCA) functions as matrix and helps in facilitating ionization of proteins and peptides in a matrix-assisted laser desorption/ionization (MALDI) time-of-flight (TOF) mass spectrometer. Application It was

Anti-ANP32A acidic (leucine-rich) nuclear phosphoprotein 32

Immunogen MDH1B (NP_001034934.1, 1 a.

Immunogen PHF23 (NP_077273.2, 1 a.

Immunogen Synthetic peptide directed towards the N terminal region of human PHF23 Biochem/physiol Actions PHF23 contains 1 PHD-type zinc finger. It belongs to the PHF23 family.

Immunogen Synthetic peptide directed towards the N terminal region of human PHLDA3 Sequence Synthetic peptide located within the following region: LQLFEAKGTGGRPKELSFARIKAVECVESTGRHIYFTLVTEGGGEIDFRC Physical form Purified antibody supplied in

Anti-UCP3 uncoupling protein 3 (mitochondrial, proton carrie

Arachidonic acid-biotin was designed to allow arachidonic acid to be detected in complexes with protein binding partners such as fatty acid binding proteins (FABPs). It is thus a tool to be used in the general elucidation of the signaling and

General description Build amino acids: monosaccharides, glycerol, fatty acids, steroids, purines and pyrimidines, peptides, disaccharides, lipids, nucleosides, nucleotides, proteins, polysaccharides, nucleic acids with this advanced student set in

Other Notes To gain a comprehensive understanding of our extensive range of Monosaccharides for your research, we encourage you to visit our Carbohydrates Category page.

Other Notes To gain a comprehensive understanding of our extensive range of Monosaccharides for your research, we encourage you to visit our Carbohydrates Category page.