Peptide Synthesis

General description The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes.

General description ADRB1 is a beta-adrenergic receptors mediate the catecholamine-induced activation of adenylate cyclase through the action of G proteins. This receptor binds epinephrine and norepinephrine with approximately equal affinity.

General description The protein encoded by this gene belongs to the family of beta adrenergic receptors, which mediate catecholamine-induced activation of adenylate cyclase through the action of G proteins. This receptor is located mainly in the

Specificity Recognizes amyloid precursor protein (APP). In Alzheimer&#8242s disease, this protein is broken down and releases the 12 amino acid b-amyloid protein that is found in senile plaques and vessels.

Immunogen Synthetic peptide directed towards the N terminal region of human ANGPTL3 Biochem/physiol Actions The protein encoded by this gene is a member of the angiopoietin-like family of secreted factors. It is predominantly expressed in the

Immunogen Synthetic peptide directed towards the N terminal region of human APOBEC2 Biochem/physiol Actions APOBEC2 belongs to the cytidine and deoxycytidylate deaminase family. It is probable C to U editing enzyme whose physiological substrate is

Immunogen Synthetic peptide directed towards the N terminal region of human ASPH Biochem/physiol Actions ASPH is thought to play an important role in calcium homeostasis. Alternative splicing of this gene results in five transcript variants

Immunogen Synthetic peptide directed towards the N terminal region of human BHMT Biochem/physiol Actions BHMT is a cytosolic enzyme that catalyzes the conversion of betaine and homocysteine to dimethylglycine and methionine, respectively. Defects

General description Homocysteine is a sulfur-containing amino acid that plays a crucial role in methylation reactions. Transfer of the methyl group from betaine to homocysteine creates methionine, which donates the methyl group to methylate DNA,

General description The protein encoded by this gene belongs to the pentaxin family. It is involved in several host defense related functions based on its ability to recognize foreign pathogens and damaged cells of the host and to initiate their

Immunogen Synthetic peptide directed towards the middle region of human CAPNS1 Sequence Synthetic peptide located within the following region: RRYSDESGNMDFDNFISCLVRLDAMFRAFKSLDKDGTGQIQVNIQEWLQL Physical form Purified antibody supplied in 1x

General description Carboxypeptidase M (UniProt: D4A9Q5: also known as CPM) is encoded by the Cpm gene (Gene ID: 314855) in rat. Rat CPM a glycosylphosphatidylinositol (GPI) anchored metallo-carboxypeptidase that cleaves basic carboxyl-terminal