Peptide Synthesis

Immunogen Synthetic peptide directed towards the middle region of human NFS1 Biochem/physiol Actions Iron-sulfur clusters are required for the function of many cellular enzymes. The protein encoded by this gene supplies inorganic sulfur to these

General description NPY2R is a receptor for neuropeptide Y and peptide YY. The rank order of affinity of this receptor for pancreatic polypeptides is PYY > NPY > PYY (3-36) > NPY (2-36) &gt:[Ile-31, Gln-34] PP &gt:[Leu-31, Pro-34] NPY > PP,

Immunogen Synthetic peptide directed towards the N terminal region of human OGDH Sequence Synthetic peptide located within the following region: MFHLRTCAAKLRPLTASQTVKTFSQNRPAAARTFQQIRCYSAPVAAEPFL Physical form Purified antibody supplied in 1x

General description This gene encodes a key acute phase plasma protein. Because of its increase due to acute inflammation, this protein is classified as an acute-phase reactant.

General description Peptidylglycine &#945:-amidating monooxygenase (PAM) is expressed in endocrine cells and neurons. It consists of two enzyme activities- peptidyl-glycine &#945:-hydroxylating monoxygenase (PHM) and peptidyl-&#945:-hydroxyglycine

Immunogen Synthetic peptide directed towards the N terminal region of human PAOX Biochem/physiol Actions PAOX belongs to the flavin monoamine oxidase family. PAOX is a flavoenzyme which catalyzes the oxidation of N(1)-acetylspermine to

Immunogen Synthetic peptide directed towards the middle region of human PAOX Biochem/physiol Actions PAOX belongs to the flavin monoamine oxidase family. PAOX is a flavoenzyme which catalyzes the oxidation of N(1)-acetylspermine to spermidine

General description This gene is a tumor suppressor and encodes a protein that binds to the eukaryotic translation initiation factor 4A1 and inhibits its function by preventing RNA binding. Alternative splicing results in multiple transcript

General description This gene encodes one of four mammalian counterparts to the fruit fly &#8242:dunce&#8242: gene. The encoded protein has 3&#8242:,5&#8242:-cyclic-AMP phosphodiesterase activity and degrades cAMP, which acts as a signal

Immunogen Synthetic peptide directed towards the N terminal region of human PDHB Biochem/physiol Actions The pyruvate dehydrogenase complex catalyzes the overall conversion of pyruvate to acetyl-CoA and CO2. It contains multiple copies of three

General description This gene encodes a mitochondrial enzyme that catalyzes the conversion of oxaloacetate to phosphoenolpyruvate in the presence of guanosine triphosphate (GTP). A cytosolic form of this protein is encoded by a different gene and

General description The protein encoded by this gene belongs to the peptidase C12 family. This enzyme is a thiol protease that hydrolyzes a peptide bond at the C-terminal glycine of ubiquitin.