Peptide Synthesis

Immunogen Synthetic peptide directed towards the C terminal region of human PGS1 Application Anti-PGS1 antibody produced in rabbit is suitable for western blotting at a concentration of 0.25&#956g/ml and for immunohistochemistry of

General description Podoplanin (PDPN) is a transmembrane sialoglycoprotein. It consists of 162 amino acids and is part of the type-1 transmembrane sialomucin-like glycoprotein family.

General description Podoplanin is part of the type-1 transmembrane sialomucin-like glycoprotein family. The gene encoding this 43kDa protein is localized on rat chromosome 5.

Neuroendocrine convertase 2 (EC 3.4.

General description PMSA (FOLH1) is a type II transmembrane glycoprotein belonging to the M28 peptidase family. Three functionally distinct proteins are encoded, including folylpoly-gamma-glutamate carboxypeptidase in the intestine, N-acetylated

Immunogen Synthetic peptide directed towards the N terminal region of human PTBP2 Biochem/physiol Actions The protein encoded by this gene binds to the intronic cluster of RNA regulatory elements, downstream control sequence (DCS). It is

Immunogen Synthetic peptide directed towards the N terminal region of mouse RBM14 Biochem/physiol Actions RBM14 is a RNA-binding protein (RBP). RBP contribute to gene expression by regulating the form, abundance, and stability of both coding and

Immunogen Synthetic peptide directed towards the C terminal region of human RGS6 Biochem/physiol Actions Members of the RGS (regulator of G protein signaling) family have been shown to modulate the functioning of G proteins by activating the

Immunogen The immunogen for anti-RIMKLB antibody: synthetic peptide derected towards the middle region of human RIMKLB Biochem/physiol Actions Rimklb catalyzes the synthesis of beta-citryl-glutamate and N-acetyl-aspartyl-glutamate.

Immunogen Synthetic peptide directed towards the middle region of human RRAD Sequence Synthetic peptide located within the following region: YDIWEQDGGRWLPGHCMAMGDAYVIVYSVTDKGSFEKASELRVQLRRARQ Physical form Purified antibody supplied in 1x PBS

Immunogen Synthetic peptide directed towards the N terminal region of human RRAGC Sequence Synthetic peptide located within the following region: RSGKSSIQKVVFHKMSPNETLFLESTNKIYKDDISNSSFVNFQIWDFPGQ Physical form Purified antibody supplied in

Immunogen Synthetic peptide directed towards the middle region of Human SAMHD1 Biochem/physiol Actions SAMHD1 contains 1 HD domain and 1 SAM (sterile alpha motif) domain. SAMHD1 may play a role in mediating proinflammatory responses to TNF-alpha