Peptide Synthesis

Immunogen Synthetic peptide directed towards the middle region of human SLC5A8 Biochem/physiol Actions SLC5A8 has been shown to transport iodide by a passive mechanism (Rodriguez et al., 2002 [PubMed 12107270]) and monocarboxylates and

Immunogen Synthetic peptide directed towards the middle region of human SLC6A5 Biochem/physiol Actions This gene encodes a sodium- and chloride-dependent glycine neurotransmitter transporter. This integral membrane glycoprotein is responsible

General description SLC6A9 terminates the action of glycine by its high affinity sodium-dependent reuptake into presynaptic terminals. It may play a role in regulation of glycine levels in NMDA receptor-mediated neurotransmission.

Immunogen synthetic peptide corresponding to amino acids 2-23 of rat or mouse syntaxin 4 (with additional C-terminal cysteine). Physical form Lyophilized from phosphate buffered saline, pH 7.

Immunogen synthetic peptide corresponding to amino acids 2-23 of rat or mouse syntaxin 4 (with additional C-terminal cysteine). Physical form Lyophilized from phosphate buffered saline, pH 7.

Immunogen Synthetic peptide directed towards the N terminal region of human TARS Application Anti-TARS antibody produced in rabbit is suitable for western blotting at a concentration of 0.25&#956g/ml.

General description Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are

Immunogen Synthetic peptide directed towards the N terminal region of human TDO2 Biochem/physiol Actions Tryptophan 2,3-dioxygenase (EC 1.13.

General description The protein encoded by this gene acts as a homodimer and is involved in many redox reactions. The encoded protein is active in the reversible S-nitrosylation of cysteines in certain proteins, which is part of the response to

Immunogen TRIM46 (AAH69416.1, 1 a.

Immunogen Synthetic peptide directed towards the middle region of human TRIM58 Sequence Synthetic peptide located within the following region: FNQLFSGLLRPYFFICDATPLILPPTTIAGSGNWASRDHLDPASDVRDDH Physical form Purified antibody supplied in 1x

Immunogen The immunogen for anti-TRIM7 antibody: synthetic peptide derected towards the N terminal of human TRIM7 Sequence Synthetic peptide located within the following region: CIMRCWERPGAGTGTVTRTLPCPLPCPQCREPARPSQLRPNRQLAAVASL Physical form