-
Add to Cart The item has been addedCSTSCL0001-10VLA549 SHRNA-MODIFIED CELL LINE
Price: $39,632.37List Price: $44,035.96A549 SHRNA-MODIFIED CELL LINE -
Add to Cart The item has been addedMAC141ANTI-CAS9 C-TERMINAL CLONE 5F1 S. AUREUS (C005B-448090)
Price: $751.40List Price: $834.89General description CRISPR-associated endonuclease Cas9 (UniProt: J7RUA5: also known as SaCas9) is encoded by the Cas9 gene (Gene ID: in Staphylococcus aureus. CRISPR (clustered regularly interspaced short palindromic repeat) is an adaptive immune -
Add to Cart The item has been addedMAC141-25UGANTI-CAS9 C-TERMINAL CLONE 5F1 S.A (C005B-448089)
Price: $349.98List Price: $388.86General description CRISPR-associated endonuclease Cas9 (UniProt: J7RUA5: also known as SaCas9) is encoded by the Cas9 gene (Gene ID: in Staphylococcus aureus. CRISPR (clustered regularly interspaced short palindromic repeat) is an adaptive immune -
Add to Cart The item has been addedMAC142-25UGANTI-CAS9 N-TERMINAL CLONE 6H4 S. (C005B-448087)
Price: $373.84List Price: $415.38General description CRISPR-associated endonuclease Cas9 (UniProt: J7RUA5: also known as SaCas9) is encoded by the Cas9 gene (Gene ID: in Staphylococcus aureus. CRISPR (clustered regularly interspaced short palindromic repeat) is an adaptive immune -
Add to Cart The item has been addedMAC142ANTI-CAS9 N-TERMINAL CLONE 6H4 S. AUREUS (C005B-448088)
Price: $751.40List Price: $834.89General description CRISPR-associated endonuclease Cas9 (UniProt: J7RUA5: also known as SaCas9) is encoded by the Cas9 gene (Gene ID: in Staphylococcus aureus. CRISPR (clustered regularly interspaced short palindromic repeat) is an adaptive immune -
Add to Cart The item has been addedAB356492ANTI-CAS9 (CHICKEN POLYCLONAL) (C005B-239936)
Price: $751.40List Price: $834.89CRISPR-associated endonuclease Cas9 (UniProt: J7RUA5 also known as SaCas9, Cas9) is encoded by the Cas9 gene in Streptococcus aureus. Cas9 belongs to subtype II-A subfamily with one HNH Cas9-type domain. -
Add to Cart The item has been addedAB356480ANTI-CAS9 (RABBIT POLYCLONAL) (C005B-239932)
Price: $751.40List Price: $834.89CRISPR-associated endonuclease Cas9 (UniProt: J7RUA5 also known as SaCas9, Cas9) is encoded by the Cas9 gene in Streptococcus aureus. Cas9 belongs to subtype II-A subfamily with one HNH Cas9-type domain. -
Add to Cart The item has been addedAB356480-25ULANTI-CAS9 (RABBIT POLYCLONAL) (C005B-239933)
Price: $349.98List Price: $388.86CRISPR-associated endonuclease Cas9 (UniProt: J7RUA5 also known as SaCas9, Cas9) is encoded by the Cas9 gene in Streptococcus aureus. Cas9 belongs to subtype II-A subfamily with one HNH Cas9-type domain. -
Add to Cart The item has been addedSAB2107863-100ULANTI-CHRNA3
Price: $980.46List Price: $1,089.40Immunogen Synthetic peptide directed towards the N terminal region of human CHRNA3 Sequence Synthetic peptide located within the following region: LPVARASEAEHRLFERLFEDYNEIIRPVANVSDPVIIHFEVSMSQLVKVD Physical form Purified antibody supplied in -
Add to Cart The item has been addedSAB2108456-100ULANTI-CHRNA7 (C005B-330321)
Price: $828.90List Price: $921.00Immunogen Synthetic peptide directed towards the N terminal region of human CHRNA7 Sequence Synthetic peptide located within the following region: QGEFQRKLYKELVKNYNPLERPVANDSQPLTVYFSLSLLQIMDVDEKNQV Physical form Purified antibody supplied in -
Add to Cart The item has been addedAV13019-100ULANTI-CHRNA9
Price: $980.46List Price: $1,089.40Immunogen Synthetic peptide directed towards the N terminal region of human CHRNA9 Application Anti-CHRNA9 antibody produced in rabbit is suitable for western blotting at a concentration of 0.0625 μg/ml. -
Add to Cart The item has been addedSAB4200701-100ULANTI-CRISPR/CAS9 ANTIBODY MOUSE MONOCLONAL CLONE 7A9-3A3 PURIFIED FROM HYBRIDOMA CELL CULTURE (C005B-326264)
Price: $933.68List Price: $1,037.42General description CAS9, also known as clustered regularly interspaced short palindromic repeats (CRISPR)-associated protein-9 nuclease , cas5 and csn1, is the signature gene of the type II CRISPR -RuvC (RNase H-like fold) cas system. CAS9
