CD164 HUMAN RECOMBINANT (C15-1304-568)

Application

Coating a plate well (6 well plate) with this recombinant CD164 matrix protein in HSC cell specific medium at 1-10 μg/well allows for human HSC / receptor interaction studies in vitro.

Use this procedure as a guideline to determine optimal coating conditions for the culture system of choice.
1. Thaw CD164 and dilute to desired concentration using serum-free medium or PBS. The final solution should be sufficiently dilute so the volume added covers the surface evenly (1-10 μg/well, 6 well plate).
Note: Use 1 ml PBS per well in a 6-well plate.
2. Add 1 - 10 μg protein to each well and incubate at 2 to 10 °C overnight.
3. After incubation, aspirate remaining material.
4. Plates are ready for use. They may also be stored at 2-8 °C damp or air dried if sterility is maintained

Sequence

MASMTGGQQMGRGHHHHHHGNLYFQGGEFDKNTTQHPNVTTLAPISNVTSAPVTSLPLVTTPAPETCEGRNSCVSCFNVSVVNTTCFWIECKDESYCSHNSTVSDCQVGNTTDFCSVSTATPVPTANSTAKPTVQPSPSTTSKTVTTSGTTNNTVTPTSQPVRKSTFD

Preparation Note

The full-length extracellular domain of the human CD164 cDNA (24 - 162 aa) was constructed with 29 N-terminal T7/HIS-tag and expressed in E. coli as inclusion bodies. The final product was refolded using a unique “temperature shift inclusion body refolding” technology and chromatographically purified as soluble protein.

biological source: human. recombinant: expressed in E. coli. description: 0.05 mg of recombinant human CD164 in 20 mM Tris-HCl buffer, containing NaCl, KCl, EDTA, L-arginine, DTT and glycerol.. sterility: Filtered sterilized solution. Assay: ≥. 90% (SDS-PAGE). form: liquid. packaging: pkg of 50 . μ. g. concentration: 0.5 . mg protein/mL. accession no.: NP_006007. UniProt accession no.: Q04900. storage temp.: −. 20°C. Gene Information: human ... CD164(8763). Storage Class Code: 10 - Combustible liquids. WGK: WGK 2. Flash Point(F): Not applicable. Flash Point(C): Not applicable.