Application
Coating a plate well (6 well plate) with this recombinant CD86 protein in T cell specific medium at 1-10 μg/well allows for use as 1) a coating matrix protein for human T cell/ receptor interaction or as a highly purified recombinant antigen or 2) as a culture matrix protein for T cell differentiation regulation studies in vitro.
Use this procedure as a guideline to determine optimal coating conditions for the culture system of choice.
1. Thaw CD86 and dilute to desired concentration using serum-free medium or PBS. The final solution should be sufficiently dilute so the volume added covers the surface evenly (1-10 μg/well, 6 well plate).
2. Add appropriate amount of diluted material to culture surface.
3. Incubate at room temperature for approximately 1.5 hours.
4. Aspirate remaining material.
5. Rinse plates carefully with water and avoid scratching bottom surface of plates.
6. Plates are ready for use. They may also be stored at 2-8 °C damp or air dried if sterility is maintained.
Sequence
MASMTGGQQMGRGHHHHHHGNLYFQGGEFELPLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTIEYDGIMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELEDPQPPPDHIP
Preparation Note
The full-length extracellular domain of the human CD86 gene (24 - 247 aa, Isoform-2) was constructed with 31 N-terminal T7/HIS-tag and expressed in E. coli as inclusion bodies. The final product was refolded using our unique “temperature shift inclusion body refolding†technology and chromatographically purified as soluble protein.
biological source: human. recombinant: expressed in E. coli. description: 0.1 mg recombinant human CD86 in 20 mM Tris-HCl buffer, containing NaCl, KCl, EDTA, L-arginine, DTT and glycerol.. sterility: Filtered sterilized solution. Assay: ≥. 90% (SDS-PAGE). form: liquid. packaging: pkg of 100 . μ. g. concentration: 0.5 . mg protein/mL. accession no.: NP_008820. UniProt accession no.: P42081. storage temp.: −. 20°C. Gene Information: human ... CD86(942). Storage Class Code: 10 - Combustible liquids. WGK: WGK 2. Flash Point(F): Not applicable. Flash Point(C): Not applicable.- UPC:
- 41106309
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- 5096-100UG