-
HPA040511-100UL
Anti-C11orf54 antibody produced in rabbit (C15-1456-237)
Price: $928.29List Price: $1,031.43Immunogen chromosome 11 open reading frame 54 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
HPA039493-100UL
Anti-C11orf57 antibody produced in rabbit (C15-1455-769)
Price: $928.29List Price: $1,031.43Immunogen chromosome 11 open reading frame 57 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
HPA039892-100UL
Anti-C11orf57 antibody produced in rabbit (C15-1455-947)
Price: $928.29List Price: $1,031.43Immunogen chromosome 11 open reading frame 57 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
HPA036591-100UL
Anti-C11orf58 antibody produced in rabbit (C15-1454-440)
Price: $928.29List Price: $1,031.43Immunogen Small acidic protein recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
HPA076406-100UL
Anti-C11orf58 antibody produced in rabbit (C15-1466-875)
Price: $928.29List Price: $1,031.43Immunogen chromosome 11 open reading frame 58 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
HPA040344-100UL
Anti-C11orf63 antibody produced in rabbit (C15-1456-149)
Price: $928.29List Price: $1,031.43Immunogen chromosome 11 open reading frame 63 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
HPA077748-100UL
Anti-C11orf63 antibody produced in rabbit (C15-1467-083)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to chromosome 11 open reading frame 63 Sequence ELSDSDLEEKSSSLSPYVKSSSSHNEVFLPGSRGPRRRKSKQHFVEKNKLTLGLPTPKTDSYLQLHNKKRGESHPEQ Application All Prestige Antibodies Powered by Atlas Antibodies are developed -
HPA045938-100UL
Anti-C11orf68 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen chromosome 11 open reading frame 68 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
HPA038585-100UL
Anti-C11orf70 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen chromosome 11 open reading frame 70 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
HPA063943-100UL
Anti-C11orf71 antibody produced in rabbit (C15-1464-527)
Price: $928.29List Price: $1,031.43Immunogen chromosome 11 open reading frame 71 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
HPA074787-100UL
Anti-C11orf71 antibody produced in rabbit (C15-1466-614)
Price: $928.29List Price: $1,031.43Immunogen chromosome 11 open reading frame 71 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
HPA044880-100UL
Anti-C11orf74 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen chromosome 11 open reading frame 74 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,