-
HPA060520-100UL
Anti-C14orf2 antibody produced in rabbit (C15-1463-559)
Price: $977.14List Price: $1,085.71Immunogen chromosome 14 open reading frame 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
HPA059635-100UL
Anti-C14orf28 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen chromosome 14 open reading frame 28 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
HPA001580-100UL
Anti-C14orf37 antibody produced in rabbit (C15-1445-341)
Price: $879.43List Price: $977.14Immunogen chromosome 14 open reading frame 37 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
HPA001789-100UL
Anti-C14orf37 antibody produced in rabbit (C15-1445-412)
Price: $879.43List Price: $977.14Immunogen Uncharacterized protein C14orf37 precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
HPA059518-100UL
Anti-C14orf39 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen chromosome 14 open reading frame 39 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
HPA042052-100UL
Anti-C14ORF79 antibody produced in rabbit (C15-1457-039)
Price: $928.29List Price: $1,031.43Immunogen chromosome 14 open reading frame 79 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
HPA061117-100UL
Anti-C14orf79 antibody produced in rabbit (C15-1463-702)
Price: $928.29List Price: $1,031.43Immunogen chromosome 14 open reading frame 79 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
HPA039961-100UL
Anti-C15orf39 antibody produced in rabbit (C15-1455-993)
Price: $928.29List Price: $1,031.43Immunogen Uncharacterized protein C15orf39 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA041907-100UL
Anti-C15orf39 antibody produced in rabbit (C15-1456-952)
Price: $928.29List Price: $1,031.43Immunogen chromosome 15 open reading frame 39 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
HPA012943-100UL
Anti-C15orf48 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen Recombinant protein corresponding to chromosome 15 open reading frame 48 Sequence TDVILDRKKNPEPWETVDPTVPQKLITINQQWKPIEELQ Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein -
HPA040484-100UL
Anti-C15orf52 antibody produced in rabbit (C15-1456-227)
Price: $928.29List Price: $1,031.43Immunogen chromosome 15 open reading frame 52 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
HPA041834-100UL
Anti-C15orf52 antibody produced in rabbit (C15-1456-912)
Price: $928.29List Price: $1,031.43Immunogen chromosome 15 open reading frame 52 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,