-
HPA055389-100UL
Anti-C16orf59 antibody produced in rabbit (C15-1462-000)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to chromosome 16 open reading frame 59 Sequence EKAVRVRRGITKAGERDKAPSLKSRSIVTSSGTTASAPPHSPGQAGGHASDTRPTKGLRQTTVPAKGHPERRLLSVGDGTRVGM Application All Prestige Antibodies Powered by Atlas Antibodies are -
HPA042969-100UL
Anti-C16orf62 antibody produced in rabbit (C15-1457-452)
Price: $928.29List Price: $1,031.43Immunogen chromosome 16 open reading frame 62 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
HPA053547-100UL
Anti-C16orf62 antibody produced in rabbit (C15-1461-369)
Price: $928.29List Price: $1,031.43Immunogen chromosome 16 open reading frame 62 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
HPA041131-100UL
Anti-C16orf70 antibody produced in rabbit (C15-1456-537)
Price: $928.29List Price: $1,031.43Immunogen chromosome 16 open reading frame 70 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
HPA041214-100UL
Anti-C16orf70 antibody produced in rabbit (C15-1456-582)
Price: $928.29List Price: $1,031.43Immunogen chromosome 16 open reading frame 70 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
HPA049468-100UL
Anti-C16orf71 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen chromosome 16 open reading frame 71 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
HPA041568-100UL
Anti-C16orf72 antibody produced in rabbit (C15-1456-767)
Price: $928.29List Price: $1,031.43Immunogen chromosome 16 open reading frame 72 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
HPA067492-100UL
Anti-C16orf72 antibody produced in rabbit (C15-1465-315)
Price: $928.29List Price: $1,031.43Immunogen chromosome 16 open reading frame 72 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
HPA049367-100UL
Anti-C16ORF74 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen chromosome 16 open reading frame 74 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
HPA073475-100UL
Anti-C16orf86 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen chromosome 16 open reading frame 86 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
HPA041179-100UL
Anti-C16orf87 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen chromosome 16 open reading frame 87 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
HPA013613-100UL
Anti-C16orf89 antibody produced in rabbit (C15-1447-998)
Price: $879.43List Price: $977.14Immunogen Uncharacterized protein C16orf89 Precursor Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive