-
HPA026988-100UL
Anti-C1orf162 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen transmembrane protein C1orf162 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA039114-100UL
Anti-C1orf167 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen Uncharacterized protein C1orf167 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA008270-100UL
Anti-C1orf174 antibody produced in rabbit (C15-1447-097)
Price: $879.43List Price: $977.14Chromosome 1 open reading frame 174 (C1orf174) was identified in exosomes isolated from meternal plasma. It localizes in the nucleus. -
HPA065778-100UL
Anti-C1orf174 antibody produced in rabbit (C15-1464-960)
Price: $928.29List Price: $1,031.43Immunogen chromosome 1 open reading frame 174 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
HPA045779-100UL
Anti-C1ORF189 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen chromosome 1 open reading frame 189 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
HPA049684-100UL
Anti-C1orf194 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen chromosome 1 open reading frame 194 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
HPA004798-100UL
Anti-C1orf198 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen Uncharacterized protein C1orf198 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA045602-100UL
Anti-C1orf204 antibody produced in rabbit (C15-1458-578)
Price: $928.29List Price: $1,031.43Immunogen chromosome 1 open reading frame 204 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
HPA051028-100UL
Anti-C1orf204 antibody produced in rabbit (C15-1460-499)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to chromosome 1 open reading frame 204. Sequence SGVDFPQVSAWMRALPSPDCPGLRTTGEQMQKLLLKENKVKTRKSKRRSGEGSHLTTSILEQ Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated -
HPA026831-100UL
Anti-C1orf21 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen Uncharacterized protein C1orf21 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA013788-100UL
Anti-C1orf210 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen Chromosome 1 open reading frame 210 (C1orf210) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
HPA028299-100UL
Anti-C1orf216 antibody produced in rabbit (C15-1451-775)
Price: $879.43List Price: $977.14Immunogen UPF0500 protein C1orf216 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported