Cell Biology

Immunogen chromosome 21 open reading frame 91 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization

Immunogen Recombinant protein corresponding to chromosome 22 open reading frame 23 Sequence LQCSPTSSQRVLPSKQIASPIYLPPILAARPHLRPANMCQANGAYSREQFKPQATRDLEKEKQRLQNIFATGKDMEERKRKAPPARQKAPAPELDRFEELVKEIQERKEFLADMEALGQGKQYRGIILAEISQKLREMEDIDHRRSEE

The gene C22orf29 is also known as BOP. It may act as a novel BH3-only factor that can interacts with the regulatory network of Bcl-2 family members to regulate intrinsic apoptotic signaling.

Specificity Note: The Ensemble Gene ID has changed from ENSG00000185838 in the 46:36 release of the database to ENSG00000215012 in the 48:36 release of the database. Immunogen Uncharacterized protein C22orf29 recombinant protein epitope signature

Immunogen Uncharacterized protein C22orf31 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen chromosome 22 open reading frame 31 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization

Immunogen chromosome 22 open reading frame 39 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization

Immunogen Uncharacterized protein LOC150297 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen chromosome 22 open reading frame 46 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Immunogen C2 calcium-dependent domain containing 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen C2 calcium-dependent domain containing 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

C2CD2L (C2 domain containing protein 2 like) is a type I transmembrane protein, which has its C-terminal facing the cytosol and the N-terminal projecting into the lumen. This gene maps to human chromosome 11q23.