-
HPA052691-100UL
Anti-C2orf61 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen chromosome 2 open reading frame 61 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
HPA020869-100UL
Anti-C2orf66 antibody produced in rabbit
Price: $879.43List Price: $977.14The gene C2orf66 is mapped to human chromosome 2. Immunogen Uncharacterized protein C2orf66 Precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by -
HPA062453-100UL
Anti-C2orf70 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen chromosome 2 open reading frame 70 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
HPA048286-100UL
Anti-C3ORF14 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen chromosome 3 open reading frame 14 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA012105-100UL
Anti-C3orf18 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen Uncharacterized protein C3orf18 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA039584-100UL
Anti-C3orf20 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen chromosome 3 open reading frame 20 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
AV47715-100UL
Anti-C3ORF31 antibody produced in rabbit
Price: $759.43List Price: $843.81C3ORF31 (TAMM41 or TAM41) codes for a mitochondrial translocator assembly and maintenance protein. Rabbit Anti-C3ORF31 antibody recognizes bovine and human C3ORF31. -
HPA046432-100UL
Anti-C3ORF36 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen chromosome 3 open reading frame 36 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA007678-100UL
ANTI-C3ORF52 ANTIBODY PRODUCED IN RABBIT (C15-1446-957)
Price: $977.14List Price: $1,085.71Immunogen chromosome 3 open reading frame 52 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
HPA008119-100UL
Anti-C3orf52 antibody produced in rabbit (C15-1447-055)
Price: $879.43List Price: $977.14Immunogen TPA-induced transmembrane protein recombinant protein epitope signature tag (PrEST) Sequence AQPSQPVDELELSVLERQPEENTPLNGADKVFPSLDEEVPPAEANKESPWSSCNKNVVGRCK Application All Prestige Antibodies Powered by Atlas Antibodies are developed and -
HPA011968-100UL
Anti-C3orf52 antibody produced in rabbit (C15-1447-699)
Price: $879.43List Price: $977.14Immunogen TPA-induced transmembrane protein recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA043328-100UL
Anti-C3orf62 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen chromosome 3 open reading frame 62 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are