-
HPA027431-100UL
Anti-C8orf48 antibody produced in rabbit (C15-1451-491)
Price: $879.43List Price: $977.14The gene encoding chromosome 8 open reading frame 48 (C8orf48) is localized on human chromosome 8p22. Immunogen Uncharacterized protein C8orf48 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas -
HPA027440-100UL
Anti-C8orf48 antibody produced in rabbit (C15-1451-495)
Price: $879.43List Price: $977.14The gene encoding chromosome 8 open reading frame 48 (C8orf48) is localized on human chromosome 8p22. Immunogen Uncharacterized protein C8orf48 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas -
HPA024667-100UL
Anti-C8orf58 antibody produced in rabbit (C15-1450-847)
Price: $879.43List Price: $977.14The gene C8orf58 (chromosome 8 open reading frame 58) is mapped to human chromosome 8p21.3. -
HPA028286-100UL
Anti-C8orf58 antibody produced in rabbit (C15-1451-771)
Price: $879.43List Price: $977.14The gene C8orf58 (chromosome 8 open reading frame 58) is mapped to human chromosome 8p21.3. -
HPA044805-100UL
Anti-C8orf59 antibody produced in rabbit (C15-1458-284)
Price: $928.29List Price: $1,031.43Immunogen chromosome 8 open reading frame 59 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
HPA071903-100UL
Anti-C8orf59 antibody produced in rabbit (C15-1466-131)
Price: $928.29List Price: $1,031.43Immunogen chromosome 8 open reading frame 59 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
HPA021439-100UL
Anti-C9orf116 antibody produced in rabbit (C15-1449-864)
Price: $879.43List Price: $977.14C9orf116 (chromosome 9 open reading frame 116) is commonly referred to as PIERCE1 (p53 induced expression in rb-null cells protein 1). Immunogen UPF0691 protein C9orf116 recombinant protein epitope signature tag (PrEST) Application All Prestige -
HPA065287-100UL
Anti-C9orf116 antibody produced in rabbit (C15-1464-850)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to chromosome 9 open reading frame 116 Sequence MAEECPRACAEPVAPKATAPPERTSDYYRVSADLPGRFNNPGWFRGYRTQKAVSVYRTSN Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by -
HPA021261-100UL
Anti-C9orf135 antibody produced in rabbit (C15-1449-812)
Price: $879.43List Price: $977.14The gene C9orf135 is mapped to human chromosome 9q21.12. -
HPA021325-100UL
Anti-C9orf135 antibody produced in rabbit (C15-1449-834)
Price: $879.43List Price: $977.14The gene C9orf135 is mapped to human chromosome 9q21.12. -
HPA045268-100UL
Anti-C9orf142 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen chromosome 9 open reading frame 142 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
HPA021200-100UL
Anti-C9orf172 antibody produced in rabbit
Price: $879.43List Price: $977.14The gene C9orf172 (chromosome 9 open reading frame 172) is mapped to human chromosome 9. It encodes for an uncharacterized protein.