Cell Biology

Immunogen CASK interacting protein 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen Recombinant protein corresponding to CASK interacting protein 2 Sequence GHIHESQRGTDRIGYFPPGIVEVVSKRVGIPAARLPSAPTPLRPGFSRTPQPPAEEPPHPLTYSQLPRVGLSPDSPAGDRNSV Application All Prestige Antibodies Powered by Atlas Antibodies are developed and

CASP10 (caspase 10) is a cysteine protease consisting of two death effector domains (DEDs). It is expressed in the Gimen cells, B and T lymphoma cell lines.

Immunogen caspase 14, apoptosis-related cysteine peptidase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen caspase 2, apoptosis-related cysteine peptidase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen Synthetic peptide directed towards the N terminal region of human CASP3 Biochem/physiol Actions CASP3 is a protein which is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a

CASP3 (caspase 3), the allosteric regulator, is a member of the cysteine-aspartic acid protease (caspase) family which is involved in the inflammation and mammalian apoptosis. It consists of binding sites for small molecules and peptides.

Immunogen caspase 4, apoptosis-related cysteine peptidase recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as

Immunogen caspase 5, apoptosis-related cysteine peptidase recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as

CASP6 (caspase 6) belongs to the family of cysteine proteases called caspases. Caspases can be divided into inflammatory capases, apoptosis initiators and effector caspases, and CASP6 belongs to the effector class.

Immunogen Caspase-6 Precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by

Caspase-1 (ICE, interleukin-1b-converting enzyme) is the mammalian caspase responsible for the proteolytic conversion of the proforms of interleukin-1b and IL-18 into active cytokines. Like other caspases, caspase-1 itself is synthesized as a