-
HPA067758-100UL
Anti-CCL19 antibody produced in rabbit
Price: $977.14List Price: $1,085.71Immunogen chemokine (C-C motif) ligand 19 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
HPA019163-100UL
Anti-CCL2 antibody produced in rabbit
Price: $879.43List Price: $977.14CCL2 is a dimer and structurally comprises a triple-stranded antiparallel β-sheet, greek key motif and an irregular β- strand at N-terminus. The gene CCL2 (C-C motif chemokine 2) is mapped to human chromosome 17q11. -
HPA051210-100UL
Anti-CCL21 antibody produced in rabbit
Price: $977.14List Price: $1,085.71Immunogen chemokine (C-C motif) ligand 21 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
HPA042015-100UL
Anti-CCL23 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen chemokine (C-C motif) ligand 23 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA055883-100UL
Anti-CCL25 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen chemokine (C-C motif) ligand 25 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA077434-100UL
Anti-CCL28 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to C-C motif chemokine ligand 28 Sequence AILPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDLAAVILHVKRRRICVS Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human -
AV07048-100UL
Anti-CCL7 antibody produced in rabbit
Price: $774.86List Price: $860.95Immunogen The immunogen for anti-CCL7 antibody: synthetic peptide derected towards the N terminal of human CCL7 Application Anti-CCL7 antibody produced in rabbit is suitable for western blotting at a concentration of 0.5 μg/ml. -
HPA020273-100UL
Anti-CCM2 antibody produced in rabbit (C15-1449-558)
Price: $879.43List Price: $977.14Cerebral cavernous malformation 2 (CCM2) is an adaptor protein containing two domains and the gene encoding it is localized on human chromosome 7p. The phosphotyrosine-binding (PTB) domain in CCM2 is essential for binding to other proteins. -
HPA021669-100UL
Anti-CCM2 antibody produced in rabbit (C15-1449-971)
Price: $879.43List Price: $977.14Cerebral cavernous malformation 2 (CCM2) is an adaptor protein consisting of two domains. Structurally, it has two domains, N-terminal phosphoÂtyrosine-binding (PTB) domain and an independent domain termed as Karet domain at the C-terminal end. -
HPA065815-100UL
Anti-CCM2 antibody produced in rabbit (C15-1464-966)
Price: $928.29List Price: $1,031.43Immunogen cerebral cavernous malformation 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
HPA008434-100UL
Anti-CCM2L antibody produced in rabbit (C15-1447-141)
Price: $879.43List Price: $977.14Cerebral cavernous malformation 2-like (CCM2L) is expressed in endothelial cells during cardiovascular growth. It contains a PTB domain comprising of amino acids 45–146 that contains a long insertion between the ⓺ and ⓻ sheets. -
HPA071063-100UL
Anti-CCM2L antibody produced in rabbit (C15-1465-960)
Price: $928.29List Price: $1,031.43Immunogen cerebral cavernous malformation 2-like Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive