Cell Biology

Immunogen chemokine (C-C motif) ligand 19 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

CCL2 is a dimer and structurally comprises a triple-stranded antiparallel &#946-sheet, greek key motif and an irregular &#946- strand at N-terminus. The gene CCL2 (C-C motif chemokine 2) is mapped to human chromosome 17q11.

Immunogen chemokine (C-C motif) ligand 21 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

Immunogen chemokine (C-C motif) ligand 23 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen chemokine (C-C motif) ligand 25 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen Recombinant protein corresponding to C-C motif chemokine ligand 28 Sequence AILPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDLAAVILHVKRRRICVS Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human

Immunogen The immunogen for anti-CCL7 antibody: synthetic peptide derected towards the N terminal of human CCL7 Application Anti-CCL7 antibody produced in rabbit is suitable for western blotting at a concentration of 0.5 &#956g/ml.

Cerebral cavernous malformation 2 (CCM2) is an adaptor protein containing two domains and the gene encoding it is localized on human chromosome 7p. The phosphotyrosine-binding (PTB) domain in CCM2 is essential for binding to other proteins.

Cerebral cavernous malformation 2 (CCM2) is an adaptor protein consisting of two domains. Structurally, it has two domains, N-terminal phospho­tyrosine-binding (PTB) domain and an independent domain termed as Karet domain at the C-terminal end.

Immunogen cerebral cavernous malformation 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization

Cerebral cavernous malformation 2-like (CCM2L) is expressed in endothelial cells during cardiovascular growth. It contains a PTB domain comprising of amino acids 45–146 that contains a long insertion between the &#9466 and &#9467 sheets.

Immunogen cerebral cavernous malformation 2-like Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive