Cell Biology

CCT2 (chaperonin containing TCP1, subunit 2) gene encodes a molecular chaperone that is a subunit of the chaperonin containing TCP1 complex (CCT). This complex is also called as TCP1 ring complex (TRiC), and contains two identical stacked rings.

Immunogen T-complex protein 1 subunit &#946 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

CCT3 (chaperonin containing TCP1), a member of TCP-1 family of chaperonins, encodes a &#947 subunit of cytosolic chaperonin containing protein. This barrel-shaped molecule is widely distributed at the cytosol and centrosome of the human and mouse

CCT5 (chaperonin containing TCP1 subunit 5) is a cytosolic chaperonin containing protein involved in the organization of the cytoskeleton. It is localized in the microtubular structures and nucleus.

Immunogen T-complex protein 1 subunit epsilon recombinant protein epitope signature tag (PrEST) Sequence

Immunogen chaperonin containing TCP1, subunit 6A (zeta 1) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen chaperonin containing TCP1, subunit 6A (zeta 1) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen chaperonin containing TCP1, subunit 6A (zeta 1) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Chaperonin containing TCP1 subunit 7 (&#951) (CCT7) is a 181-amino-acid protein (21kDa) localized in the cytoplasm and nucleus. It is composed of two rings, one on top of the other, forming a cylinder.

Immunogen CD109 molecule Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen Recombinant protein corresponding to CD109 molecule Sequence GPVEILTTVTESVTGISRNVSTNVFFKQHDYIIEFFDYTTVLKPSLNFTATVKVTRADGNQLTLEERRNNVVITVTQRNYTEYWSGSNSGNQKMEAVQKINYTVPQSGTFKIEFPILEDSSELQLKAYFLGSKSSMA Application All Prestige Antibodies

This 145 kDa molecule is a member of the tyrosine kinase receptor family and is expressed by a majority of hematopoietic progenitor cells. The interaction of the mouse c-kit receptor and steel factor promotes proliferation and differentiation of