Cell Biology

Specificity The antibody recognizes a heavily glycosylated transmembrane protein: gp 105-120 kDa. The antigen is expressed on immature human haemopoietic precursor cells, capillary endothelial cells and human myeloid cells in the following

Specificity Clone 581 reacts with the class III CD34 epitope is resistant to neuraminidase, chymopapain and glycoprotease. The antibody reacts with a single-chain 105-120 kDa heavily O-glycosylated transmembrane glycoprotein which is expressed on

CD36 is a glycoprotein that functions as a receptor for thrombospondin in platelets. Studies have reported that TLR4 signaling inhibited the expression of CD36 and subsequently slowed hematoma absorption.

CD36 is a major platelet membrane glycoprotein IV. Immunogen Platelet glycoprotein 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein

Immunogen Recombinant protein corresponding to CD36 molecule Sequence LLWGYRDPFLSLVPYPVTTTVGLFYPYNNTADGVYKVFNGKDNISKVAIIDTYKGKRNLSYWESHCDMINGTDAASFPPFVEKSQVLQFFSS Application All Prestige Antibodies Powered by Atlas Antibodies are developed and

Specificity This antibody recognizes the 90 kDa single chain membrane glycoprotein (GPIIIb) that is found on monocytes/macrophages and platelets. FUSION PARTNER: NS1 myeloma cell line Immunogen Human tonsil cells and peripheral blood mononuclear

Specificity This antibody recognizes the 90 kDa single chain membrane glycoprotein (GPIIIb) that is found on monocytes/macrophages and platelets. FUSION PARTNER: NS1 myeloma cell line Immunogen Human tonsil cells and peripheral blood mononuclear

Immunogen CD37 molecule Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen CD37 molecule Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen ADP-ribosyl cyclase 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by

Immunogen CD38 molecule Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

T-cell surface glycoprotein CD3 epsilon chain (UniProt P07766 also known as CD3-epsilon, CD3e, T-cell surface antigen T3/Leu-4 epsilon chain) is encoded by the CD3E (also known as T3E) gene (Gene ID 916) in human. The T cell receptor or TCR is a