-
HPA018452-100UL
Anti-CD99L2 antibody produced in rabbit (C15-1449-022)
Price: $879.43List Price: $977.14Immunogen Uncharacterized protein C21orf136 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA038782-100UL
Anti-CD99L2 antibody produced in rabbit (C15-1455-441)
Price: $928.29List Price: $1,031.43Immunogen CD99 molecule-like 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
HPA038783-100UL
Anti-CD99L2 antibody produced in rabbit (C15-1455-442)
Price: $928.29List Price: $1,031.43Immunogen CD99 molecule-like 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
HPA061400-100UL
Anti-CD99L2 antibody produced in rabbit (C15-1463-779)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to CD99 molecule like 2 Sequence QQKKFCFSIQQGLNADYVKGENLEAVVCEEPQVKYSTLHTQSAEPP Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) -
HPA047615-100UL
Anti-CDADC1 antibody produced in rabbit (C15-1459-287)
Price: $928.29List Price: $1,031.43Immunogen cytidine and dCMP deaminase domain containing 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA058314-100UL
Anti-CDADC1 antibody produced in rabbit (C15-1462-906)
Price: $928.29List Price: $1,031.43Immunogen cytidine and dCMP deaminase domain containing 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA039404-100UL
Anti-CDAN1 antibody produced in rabbit (C15-1455-715)
Price: $928.29List Price: $1,031.43Immunogen congenital dyserythropoietic anemia, type I recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
HPA040787-100UL
Anti-CDAN1 antibody produced in rabbit (C15-1456-360)
Price: $928.29List Price: $1,031.43Immunogen codanin 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The -
HPA037830-100UL
Anti-CDC123 antibody produced in rabbit (C15-1454-933)
Price: $928.29List Price: $1,031.43Immunogen cell division cycle 123 homolog (S. cerevisiae) recombinant protein epitope signature tag (PrEST) Application Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below. -
HPA057540-100UL
Anti-CDC123 antibody produced in rabbit (C15-1462-684)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to cell division cycle 123 Sequence DSLLFTWEELISENNLNGDFSEVDAQEQDSPAFRCTNSEVTVQPSPYLSYRLPKDFVDLSTGEDAHKLIDFLKLKRNQQEDD Application All Prestige Antibodies Powered by Atlas Antibodies are developed and -
HPA023783-100UL
Anti-CDC14A antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen Dual specificity protein phosphatase CDC14A recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
HPA013312-100UL
Anti-CDC14B antibody produced in rabbit (C15-1447-944)
Price: $879.43List Price: $977.14Immunogen Dual specificity protein phosphatase CDC14B recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a