-
HPA064747-100UL
Anti-CDC14B antibody produced in rabbit (C15-1464-719)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to cell division cycle 14B Sequence RCSSTSPGVKKIRSSTQQDPRRRDPQDDVYLDITDRLCFAILYSRPKSASNVHY Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein -
HPA042826-100UL
Anti-CDC16 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen cell division cycle 16 homolog ( S. cerevisiae ) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as -
AB3241-25UL
Anti-Cdc2 Antibody, phospho-specific (Tyr15) (C15-1316-039)
Price: $319.59List Price: $355.10Specificity CDC2, phosphoTyr15. By Western blot the antibody recognizes the ~35 kDa phospho CDC2 protein. -
HPA045842-100UL
Anti-CDC20 antibody produced in rabbit (C15-1458-659)
Price: $928.29List Price: $1,031.43Immunogen cell division cycle 20 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA055288-100UL
Anti-CDC20 antibody produced in rabbit (C15-1461-967)
Price: $928.29List Price: $1,031.43Immunogen cell division cycle 20 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA053900-100UL
Anti-CDC20B antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen cell division cycle 20 homolog B (S. cerevisiae) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as -
HPA039593-100UL
Anti-CDC23 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen cell division cycle 23 homolog ( S. cerevisiae ) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as -
HPA008803-100UL
ANTI-CDC25A ANTIBODY PRODUCED IN RABBIT
Price: $977.14List Price: $1,085.71Immunogen cell division cycle 25A Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
AV03041-100UL
Anti-CDC25B (AB2) antibody produced in rabbit
Price: $819.43List Price: $910.48Immunogen Synthetic peptide directed towards the N terminal region of human CDC25B Application Anti- CDC25B (AB2) antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/ml. For immunohistochemistry of -
HPA038892-100UL
Anti-CDC25B antibody produced in rabbit (C15-1455-494)
Price: $928.29List Price: $1,031.43Immunogen cell division cycle 25B Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA038893-100UL
Anti-CDC25B antibody produced in rabbit (C15-1455-495)
Price: $928.29List Price: $1,031.43Immunogen cell division cycle 25B Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA066991-100UL
Anti-CDC25C antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen cell division cycle 25C Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the